KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4356Help
Entry
Rahaq2_4356       CDS       T01770                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rahaq2_4356
Enzymes [BR:raq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rahaq2_4356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4639389..4640138
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEALVSRLRALGRVAFHSPLIDFAPGNQLASLPNLLSSLNQQDLVFLLS
QHAVSYADRALRQSATNWPDTVNYFAIGRTTGLIFHRVSSLPVLYPQDGETSEMLLNLPA
LQRIQGKKALILRGNGGRELLAETLTERGVDVTYCECYQRSPVYYDASEQSALWQRAGID
TLVVTSGEMLQQLYQLVPDYYRHSWLLRCNLVVVSERLAALARQLGWRAIRVAENADNDA
LIRALQLPD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctggtcacccgcccctctccggcaggagaagcactggtcagccggctgcgc
gcactgggccgggttgccttccattccccgctgattgattttgcaccggggaaccagctc
gcatcgctgccgaacctgctatcctcattaaatcagcaagatctggtgtttttgctctcg
cagcatgcggtcagttacgctgaccgggctttgcgtcagtccgccacaaactggccggac
accgtgaattattttgccattggtcgcaccacgggcctgattttccaccgggtcagcagc
ctgcctgttctctatcctcaggatggcgaaaccagcgaaatgttattgaatcttccggca
ttgcaacgcatacagggcaaaaaagcgctgatattgcgtggtaatggcggacgggaattg
ttagccgaaacgctgacagaacgcggggtcgatgtgacttactgcgaatgttatcagcgc
agcccggtttactacgatgccagtgaacagagtgcgctctggcaacgggccggaattgat
acgctggtcgtgaccagcggagaaatgctgcaacagctgtatcagttagttcctgattac
taccgacattcatggttactgcgctgtaatctggtggtggtcagtgaacgtttagcagcc
ctcgcccgccagcttggctggcgcgcaattcgggttgctgagaatgcagacaatgatgcg
ctgatccgcgcattacaactacctgactaa

DBGET integrated database retrieval system