KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4358Help
Entry
Rahaq2_4358       CDS       T01770                                 

Definition
(GenBank) hemY protein
  KO
K02498  HemY protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemY_N TPR_2 TPR_16 TPR_1 TPR_14 TPR_19 TPR_11 LPG_synthase_TM TRAPPC9-Trs120 TPR_9 DUF1835 TPR_6 DUF4834
Motif
Other DBs
NCBI-ProteinID: AEX54110
UniProt: H2IWR1
Position
4641307..4642503
Genome map
AA seq 398 aa AA seqDB search
MLRVFVLFLIVFAGIIVGPILAGHQGYVLIQTDNYNIETSVTGLVIMLIVLILVLFIIEW
FLRRVLRTGARTRGWFAGRKSSKARKQTHAAMLKLAEGDHRQMEKLLARNADHAEQPVVN
YLLAAEAAQQRGDDIRTNQYLERAAEIADTDQMPVDITRVRIQLARGEVHAARHGVDRLL
GQSPRHPEVLRLAEQAYLLTGAYGSLLEILPSMAKADVHNDDEIRVLQEQAYIGMMNQLM
AEEGSEGLKRWWKDQSRKTRHEVALQVAMATHLIECNDQDLAQEVILDGLKRQYDDRLVA
LMPKLRSGNPEQLEKTLRQLIKQNGTTPLLSSTLGQLLMKHGEWQQASEAFREALKQRPD
AYDYAWLADALDKLHKPAEAAEMRREGLMLTLNNSQQP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctacgagttttcgtgttgttcctgattgtgtttgccgggattatcgtcggcccgatt
ctggccggccatcagggctatgtcctgatccagaccgacaattacaacatcgaaaccagc
gtcaccggtttagtcatcatgctgatcgtgctgattctggtgctgttcatcattgaatgg
ttcctgcgccgcgttctgcgtaccggtgcacgtacccgaggctggtttgccggacgcaaa
agctctaaagcgcgtaagcaaactcacgcagccatgctcaaactcgcggaaggcgaccat
cgtcagatggaaaaactgctggcgcgcaatgccgatcacgccgaacaaccggtggtgaac
tatttactggcagcggaagcggcgcagcagcgcggcgatgatatccgcaccaatcagtat
ctggagcgtgcagcggaaatcgcagataccgaccagatgccggttgatatcacccgcgtg
cgtatccagctggccagaggcgaggttcacgcagcacgccacggtgttgatcgtttactg
ggccagtcgccacgtcatccggaagtcttacgtctggcagagcaggcttatcttctgacc
ggcgcttacggttcactgctggagattttaccgtcgatggcaaaagccgatgttcataac
gacgatgaaatccgtgtgcttcaggagcaggcttatatcggaatgatgaatcagctgatg
gcggaagaaggcagtgaaggcctgaagcgctggtggaaagatcagagccgtaaaacccgt
catgaagtggccttacaggtcgcaatggcaacgcatctgattgaatgcaacgatcaggat
ctggcgcaggaagtgatcctcgacgggctgaaacgccagtacgacgatcggctggtcgcg
ctgatgccgaagctgcgttcgggtaatcctgagcaactggaaaaaacactgcgtcagttg
atcaaacagaatggcacaacgccgctgctcagcagcacgctgggtcagttgctgatgaaa
cacggtgaatggcaacaggcaagtgaagccttccgtgaggcgctgaaacaacgccctgac
gcgtatgattacgcctggctggctgatgcgctggataagctgcataaaccggcagaagcg
gcggaaatgcgccgcgaagggctgatgctgaccctgaataattcgcagcaaccttaa

DBGET integrated database retrieval system