KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4436Help
Entry
Rahaq2_4436       CDS       T01770                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:raq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4724477..4726000
Genome map
AA seq 507 aa AA seqDB search
MSADTTHEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKSGWVEHDPMEIWS
SQSSVLVEVLAKADINSDQIAGIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEK
LKKDGMEEYIRHNTGLVIDPYFSGTKLKWILDHVEGSRERAKRGELLFGTVDTWLVWKMT
QGRVHVTDYTNASRTMLFNIHDLQWDDRMLEVLDIPREMLPEVRPSSEIYGQTNIGGKGG
TRIPIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEAVASKNGLLTTIACGP
RGEVNYALEGAVFVGGASIQWLRDELKLISDATDSEYFAMKVKDTNGVYVVPAFTGLGAP
YWDPYARGAIFGLSRGANSNHIIRATLESIAYQTRDVLDAMQADSGARLQSLRVDGGAVA
NNFLMQFQSDILGTRVERPEVLEVTALGSAFLAGLAVGFWNDLEEVRSKAIIEREFRPGI
ETTERNVRYKGWQKAVARVRSWEDHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagatacgactcacgaaaaaaaatacattgttgcactcgaccagggtacaacc
agttcacgcgccgtagttctggatcacgatgccaatatcgtcagcgtgtcacaacgcgaa
ttcacccagatttaccctaagtcaggctgggttgagcacgacccgatggaaatctggtca
tcgcaaagctcggtgctggttgaagtgctggcgaaagccgacattaactccgatcagatt
gccggtatcggtatcaccaaccagcgtgaaaccactatcgtgtgggaaaaagaaaccggc
aagccaatctataacgcgattgtctggcaatgtcgccgtactgctgacatctgcgaaaag
ctgaaaaaagacggcatggaagaatacatccgtcacaacaccggcctggtgattgacccg
tacttctccggcaccaaactgaagtggatccttgaccacgttgaaggctcccgcgaacgg
gctaaacgcggcgaactgctgttcggcaccgtcgacacctggttggtctggaaaatgacg
cagggacgtgttcacgtgacggattacaccaacgcctcacgtaccatgctgttcaacatc
catgatctgcaatgggatgaccgcatgctggaagtgctggatattccgcgtgaaatgctg
ccggaagttcgcccttcttctgagatttacggccagaccaacattggtggtaaaggcggt
acgcgtatccctatcgccggtatcgcgggtgaccagcaggcggcgctgtatggccagctg
tgtgtgcaaccgggtatggcgaagaatacctacggcactggctgcttcctgctgatgaat
accggtactgaagccgttgcctctaaaaatggcctgctgaccaccatcgcctgtggcccg
cgcggcgaagtaaactatgcgctggaaggtgccgtgtttgtcggcggtgcgtccattcag
tggttgcgtgatgaactgaagcttatcagcgacgcaaccgactccgaatatttcgctatg
aaagtgaaagacaccaacggcgtttacgtggtgcccgccttcaccggcctcggtgcgcct
tactgggacccgtatgcccgcggcgctatcttcggtctgagccgtggtgcgaacagcaac
cacattatccgtgcaacgctggaatctatcgcttaccagacccgcgacgtactggatgcg
atgcaggctgactcaggcgctcgtctgcagtcactgcgcgttgatggcggtgcggttgcc
aacaacttcctgatgcaattccagtcagacattctcggcacccgcgttgagcgccccgaa
gtgctggaagtcaccgcactgggctctgctttcctcgccgggctggctgtcggtttctgg
aacgatctggaagaagtgcgcagcaaagccatcatcgagcgtgaattccgcccaggtatc
gaaacgacggaacgcaatgtccgctataaaggctggcaaaaagcagtggcacgcgttcgt
tcgtgggaagatcacgacgagtaa

DBGET integrated database retrieval system