KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4442Help
Entry
Rahaq2_4442       CDS       T01770                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_4442
   01230 Biosynthesis of amino acids
    Rahaq2_4442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_4442
   00051 Fructose and mannose metabolism
    Rahaq2_4442
   00562 Inositol phosphate metabolism
    Rahaq2_4442
Enzymes [BR:raq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rahaq2_4442
Exosome [BR:raq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rahaq2_4442
  Exosomal proteins of bladder cancer cells
   Rahaq2_4442
  Exosomal proteins of melanoma cells
   Rahaq2_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4730811..4731578
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRTELSTVVGCGVAIAPPEVYLSQAKHALAGSRIA
LGAQNVDANLSGAFTGEISADMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFGVLKDAG
LTPVLCIGETEAENEAGKTEAVCAKQLDAVLSTLGAKAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaagcttaacggcagcacccacatggttaac
gaactgattgctgctctgcgtactgaactgagcacagtggtaggttgtggcgttgcaatt
gctccaccagaagtttacctgtcacaggctaaacacgctctggcgggcagccgtattgcg
ctgggtgctcagaacgttgatgctaacctgtccggcgcattcaccggtgagatctctgcc
gacatgctgaaagacatcggtgcgaaatacatcatcatcggtcactcagaacgccgcact
taccacaaagaaagcgacgagttcatcgcgaaaaaattcggtgtgctgaaagacgctggc
ctgactcctgttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaactgaa
gccgtttgcgctaaacaactggacgcggtgctgagcactctgggtgcgaaagcattcgaa
ggcgcagtcatcgcttacgaacctgtttgggcgatcggtaccggcaaatcagccaccccg
gctcaggctcaggcggttcacaaattcatccgtgaccacatcgcaaaacaagatgctgcg
gttgctgaacaagtgatcatccagtacggcggttccgttaacgcggctaacgctgctgag
ctgttcacacagccagatatcgatggcgcactggttggcggcgcatcactgaaagctgat
gctttcgcagtgatcgtgaaagcggctgcggaagccaaacaagcgtaa

DBGET integrated database retrieval system