KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4444Help
Entry
Rahaq2_4444       CDS       T01770                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00010  Glycolysis / Gluconeogenesis
raq00030  Pentose phosphate pathway
raq00051  Fructose and mannose metabolism
raq00052  Galactose metabolism
raq00680  Methane metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
raq01230  Biosynthesis of amino acids
raq03018  RNA degradation
Module
raq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_4444
   00030 Pentose phosphate pathway
    Rahaq2_4444
   00051 Fructose and mannose metabolism
    Rahaq2_4444
   00052 Galactose metabolism
    Rahaq2_4444
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_4444
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rahaq2_4444
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rahaq2_4444
Protein phosphatases and associated proteins [BR:raq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rahaq2_4444
Messenger RNA biogenesis [BR:raq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rahaq2_4444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEX54182
UniProt: H2IXJ2
Position
complement(4732850..4733836)
Genome map
AA seq 328 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSADLEVYGIEDGYLGMYENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEMRKVALQNMKDRGIDGLVVIGGDGSYAGADLLTKEGGIR
CIGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDNIEELAKYIEKET
CRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLEEDRDYSQGGFCVGVENEKMVH
ELISICIAPENKKSKFKEDWYDTAKKLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtactgacaagtggtggcgatgccccaggcatgaatgctgcg
atccgtggcgttgtccgcgccgctttgtctgcagatttggaagtctacggtattgaagat
ggctacctcggcatgtatgaaaaccgcatgcgcaaactggatcgttacagcgtctccgat
atgatcaaccgtggtggtactttcctggggtcagcacgttttccggaattccgtgatcca
gaaatgcgtaaagttgccctgcagaatatgaaagaccgcggtattgatggcctggtggtt
atcggcggtgacggttcatatgcgggtgcagacctgctgacgaaagaaggtggcatccgt
tgtatcggcctgccaggtaccatcgataacgatgttgccgggactgactacactatcggt
tttttcacagcattgggcactgtggttgaggcgattgaccgtttacgtgatacctcatcc
tcacaccagcgtatctctattgttgaagtgatgggccgctattgcggtgatttaacttta
gcggcagcgattgccgggggttgcgaatttatcgctatccctgaagtagaatttaaacgt
gatgatctggttgctgaaatcaaagccggtatcgcgaaaggtaaaaaacacgcgattgtc
gccatcaccgagaagttagataacatcgaagaactggctaaatacatcgagaaagaaacc
tgtcgtgaaacgcgtggcactgtcttaggccatattcagcgtggcggagcaccggtcgct
tatgatcgtatcctggcttcccgcatgggcgcttatgctgttgatctgctgctggaagaa
gaccgcgactattctcagggcggtttctgtgtcggcgttgaaaacgagaaaatggttcac
gaattaatctcgatttgtatcgcgccagagaacaagaaaagtaaattcaaagaagactgg
tacgatacggcgaaaaaacttttctga

DBGET integrated database retrieval system