KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4444Help
Entry
Rahaq2_4444       CDS       T01770                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_4444
   01230 Biosynthesis of amino acids
    Rahaq2_4444
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_4444
   00030 Pentose phosphate pathway
    Rahaq2_4444
   00051 Fructose and mannose metabolism
    Rahaq2_4444
   00052 Galactose metabolism
    Rahaq2_4444
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_4444
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rahaq2_4444
Protein phosphatases and associated proteins [BR:raq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rahaq2_4444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4732850..4733836)
Genome map
AA seq 328 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSADLEVYGIEDGYLGMYENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEMRKVALQNMKDRGIDGLVVIGGDGSYAGADLLTKEGGIR
CIGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDNIEELAKYIEKET
CRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLEEDRDYSQGGFCVGVENEKMVH
ELISICIAPENKKSKFKEDWYDTAKKLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtactgacaagtggtggcgatgccccaggcatgaatgctgcg
atccgtggcgttgtccgcgccgctttgtctgcagatttggaagtctacggtattgaagat
ggctacctcggcatgtatgaaaaccgcatgcgcaaactggatcgttacagcgtctccgat
atgatcaaccgtggtggtactttcctggggtcagcacgttttccggaattccgtgatcca
gaaatgcgtaaagttgccctgcagaatatgaaagaccgcggtattgatggcctggtggtt
atcggcggtgacggttcatatgcgggtgcagacctgctgacgaaagaaggtggcatccgt
tgtatcggcctgccaggtaccatcgataacgatgttgccgggactgactacactatcggt
tttttcacagcattgggcactgtggttgaggcgattgaccgtttacgtgatacctcatcc
tcacaccagcgtatctctattgttgaagtgatgggccgctattgcggtgatttaacttta
gcggcagcgattgccgggggttgcgaatttatcgctatccctgaagtagaatttaaacgt
gatgatctggttgctgaaatcaaagccggtatcgcgaaaggtaaaaaacacgcgattgtc
gccatcaccgagaagttagataacatcgaagaactggctaaatacatcgagaaagaaacc
tgtcgtgaaacgcgtggcactgtcttaggccatattcagcgtggcggagcaccggtcgct
tatgatcgtatcctggcttcccgcatgggcgcttatgctgttgatctgctgctggaagaa
gaccgcgactattctcagggcggtttctgtgtcggcgttgaaaacgagaaaatggttcac
gaattaatctcgatttgtatcgcgccagagaacaagaaaagtaaattcaaagaagactgg
tacgatacggcgaaaaaacttttctga

DBGET integrated database retrieval system