KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4522Help
Entry
Rahaq2_4522       CDS       T01770                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rahaq2_4522
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rahaq2_4522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEX54255
UniProt: H2IYC9
Position
complement(4816910..4817839)
Genome map
AA seq 309 aa AA seqDB search
MKTGKLVVLGSINADHILNINHFPQPGETVIGKQYTVAFGGKGANQAVAAGRSGADISFI
ACVGDDDIGERVRKQLASDRIDTQPIEAIKDSTTGVALIFVNAEGENVIGIDAGANKAVT
PEYLDRYKQQIISASALLMQLESPLETVIAAAKIAKDNDTQVILNPAPACELPDELLARV
DMITPNETEAEKLTGIKVDNNEDADRAAKVLHDKGIATVIITLGSKGVWLSQNGEGKLVA
GFCVKAVDTIAAGDTFNGALVTALLEGKMMDCAIRFAHAAAAIAVTRPGAQPSVPWRKEI
DDFLAQQEA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccggcaaactggtggtactcggcagtatcaacgctgaccacattttgaatatc
aaccacttcccgcaaccgggcgaaacggttattggaaagcaatacactgtagcctttggc
ggcaaaggggcgaatcaggccgttgcagccggtcgcagtggtgctgatatttcttttatt
gcctgtgtgggagatgacgatattggcgagcgcgttcgtaaacagctggccagtgaccgt
attgatacgcaacccatcgaggccatcaaagactcaaccaccggcgttgcactgattttc
gtgaatgcggaaggtgagaacgttatcggtatcgatgcgggggcgaataaagctgtgacg
ccggaataccttgatcgctataaacagcagatcatcagcgcgtctgctttattaatgcag
ctggaatcgccgcttgagacggtgattgcggcggcgaaaatcgccaaagacaacgacacg
caggttatcctcaatccggctccggcgtgtgaattgcccgatgaactgcttgcgcgggtg
gatatgatcaccccgaatgaaacagaagccgaaaagctgacggggattaaagtcgataat
aatgaagatgccgatcgcgccgcgaaagttttgcatgacaaaggcatcgcaaccgtcatc
attacattgggcagtaaaggtgtctggctgagccagaacggcgaaggaaagttggttgcg
gggttctgcgttaaagccgtcgatacgatagccgcaggtgatacctttaacggtgcatta
gtcaccgcgttgcttgaaggtaaaatgatggactgtgcgatacgattcgcgcatgcggcg
gcggcgattgccgtgacgcgccctggtgcgcaaccttctgtcccgtggcgcaaagaaata
gacgatttcctcgcacaacaggaggcctga

DBGET integrated database retrieval system