KEGG   Riemerella anatipestifer RA-GD: RIA_0441Help
Entry
RIA_0441          CDS       T02007                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rar00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:rar02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397842..398753
Genome map
AA seq 303 aa AA seqDB search
MKNILKQVAVFGLLFSVKLFFSQNYEKYSLENGFSHNDYLQTSPLIESFTLGFGLIEVDV
HWDGNNLMVAHDASEIQNDRTLETLYIKPLSKLWVEGKGRPLKLLIDLKTPWQDTLPQIQ
NLLETYPNLHQQVQFVITGNIPPKELFSQYPYYLMFDGRIGERYSQNELAKIAIISDDFK
KYTQWNGKGYPKAREKQTILETIDKVHSLGKPIRFWGSPDEINAWHTLMVYNVDYISTDQ
PKALAEVLERLAKSSYTSKVSHQPYQPKYKNFDKKRQKIFCFLYQMASLYHSYTLHIPPM
VTI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatactaaaacaagtagcagtcttcggactgctattttcagtgaagctattt
ttctctcaaaattatgaaaaatacagcttagaaaacggattttctcacaatgattacttg
cagacctcccctctaatagaaagtttcaccttaggatttgggttaatagaagtagatgta
cattgggacggcaataatcttatggttgcccacgatgcctcagaaatacagaatgataga
acactagaaaccttatatataaaaccactctcaaaactttgggttgagggaaaaggacgg
ccactgaaacttctaattgacctaaaaactccttggcaagatactttacctcaaattcaa
aacctattagagacatatccaaatctgcatcaacaggttcaatttgtaattacaggcaat
ataccacctaaagaattattttctcaatatccctattatttaatgtttgatgggagaatt
ggtgaaagatattcccaaaacgaactagcaaaaattgcaataattagtgatgatttcaag
aagtacactcaatggaatggcaaaggctatcccaaagctagagagaaacaaactattctt
gagactatagacaaagttcactccttaggaaaacctattagattttggggaagcccagat
gaaatcaatgcgtggcatacactaatggtatataatgtagattatatttcaacggaccaa
cctaaagccctagcagaagttcttgaacgactagccaaaagtagctatacttccaaagtt
tcccaccaaccctatcagcccaaatacaaaaactttgataaaaaaaggcaaaaaatattt
tgctttttataccagatggcgtctctttaccacagctatacgctgcatataccgccaatg
gtaacaatctga

DBGET integrated database retrieval system