KEGG   Riemerella anatipestifer RA-GD: RIA_0618Help
Entry
RIA_0618          CDS       T02007                                 

Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00020  Citrate cycle (TCA cycle)
rar00640  Propanoate metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIA_0618
   00640 Propanoate metabolism
    RIA_0618
   00660 C5-Branched dibasic acid metabolism
    RIA_0618
Enzymes [BR:rar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RIA_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADZ11780
Position
complement(591021..592211)
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQSKEILAKYGVRVQRGIVASTVEEAKKAAEQLSAETGTKAWVVKAQVHAGGRGK
GGGVKFSPNMEKLEENARNIIGMQLVTPQTSAEGKKVHSVLIAEDMYYPGDSEPKEYYVS
VLLDRAKGKNMIVYSTEGGMDIEQVAEETPHLIHNEEVDPALGLQPFQARKIAFNLGLEG
EAFKDFVKFITALYNAYVGIDASLFEINPVLKTSDNKIAAVDAKVTLDNNALFRHKDLAE
LRDKREEDPTEVEAGEAGLNFVKLDGNVGCMVNGAGLAMATMDIIKLSGGNPANFLDVGG
TADAERVEKAFGIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKSFGELPVPLIVRLQ
GTNAEEAKRLIDESGLPVHSAITLEEAANKVKEVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcaatcaaaagagattttagcgaaatacggcgttagagtacaa
agaggtatagtagctagcaccgtagaggaagcaaaaaaagcagcagaacagctttctgca
gaaacaggaactaaagcgtgggtagtaaaagctcaggtacacgcaggtggtagaggtaaa
ggtggaggtgttaagttttctcctaacatggaaaagttagaagaaaacgcaagaaacatc
atcggaatgcagttagtaacgcctcaaacttctgctgaaggtaaaaaagtacactctgta
cttattgcagaagatatgtattatcctggagattctgaaccaaaagaatactatgtttct
gtacttttagatagagctaaaggaaagaatatgattgtatattctacagaaggtggtatg
gatatagagcaagtggcagaagaaactccacaccttatccataacgaagaggtagatcct
gctttaggattacaacctttccaagctagaaagattgcatttaatctaggtctagaagga
gaagctttcaaggattttgtaaaattcattacagctctttataatgcttatgtaggtatt
gatgcttctttatttgaaatcaaccctgttcttaaaacttcagataacaaaatcgctgca
gtagatgctaaagtaactttagataataatgcacttttccgtcataaagatttagctgaa
ttaagagacaaaagagaggaagaccctacagaagttgaagctggtgaagctggattaaac
ttcgttaagctagacggtaacgtaggttgtatggtaaatggagctggtttagcaatggct
actatggatatcattaaactttctggaggtaaccctgctaacttcctagatgtaggtggt
actgcagatgctgaaagagtagaaaaggcatttggtattatccttaaagaccctaatgta
aaagcaattcttatcaacatctttggtggtattgtaagatgtgatagagtggcacaaggt
gtagtagatgcttacaagagcttcggagaacttccagtacctcttatcgtaagattacaa
ggaactaatgctgaagaagctaagagattaatcgacgaatctggactaccagtacattct
gcaattactctagaagaagcagcaaacaaagtaaaagaggtattagcttaa

DBGET integrated database retrieval system