KEGG   Riemerella anatipestifer RA-GD: RIA_0672Help
Entry
RIA_0672          CDS       T02007                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RIA_0672
Enzymes [BR:rar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RIA_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(652426..652986)
Genome map
AA seq 186 aa AA seqDB search
MDKVIIFSAPSGSGKTTLVKYCLEKFSNLEFSISATTRQPRGTEQDGKDYHFLSLERFKQ
LISEEAFVEYEEVYTDKFYGTLKSEVERIWKSGNTVIFDVDVVGGVNLKNIFGEKALSIF
IAPPSIKELKNRLISRGTDDEATIKIRVDKAAEELSYQDKFDKIIINDDLSVAQKEVEQV
IHQFLN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttggataaagttattatattttcggcaccatcggggagtggtaaaaccacattggtaaag
tattgtttagagaaattttccaatttggagttttctatatctgccactacaagacagccg
agaggtacagagcaagatggtaaagattatcattttttaagtttagaaaggtttaaacaa
ctgatttcagaagaggcttttgtggagtacgaagaagtctatacggataaattttatggc
acattaaaatcggaagtggagcgtatttggaagtcaggcaacaccgttatttttgatgta
gatgtagtgggaggtgttaatcttaaaaatatttttggggagaaagctctttctatattc
attgcaccgccaagtattaaggagctaaaaaacagacttatttctagagggactgatgat
gaggcaactattaaaatcagagtagataaagctgcggaagaactttcttatcaagataaa
tttgacaaaattatcattaacgatgatttatccgtagctcaaaaggaagtagaacaagtg
attcatcaatttttaaactaa

DBGET integrated database retrieval system