KEGG   Riemerella anatipestifer RA-GD: RIA_0850Help
Entry
RIA_0850          CDS       T02007                                 

Definition
Uroporphyrinogen-III synthase, divergent, Flavobacterial type
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RIA_0850
Enzymes [BR:rar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RIA_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822524..823036
Genome map
AA seq 170 aa AA seqDB search
MASSILLTKEINPEKRQLLLNEGLEVDTKDFIRIKFINTEKISLRNKTLIFTSANGVEGF
FKNGFDAPHSSVICVGGKTESKLAEKGIKTLHTAKNAEELASFILQQQWDNPDFVHFCGN
LALDTLEKSIANHNANYIKKIVYETELLYPTLNKKYDALVFLVQVEFVAL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggctagttctattctcttgactaaggaaatcaatcctgaaaaacgccaactcctgtta
aacgaaggactagaggttgataccaaagattttattagaattaaattcatcaataccgaa
aagattagtctgcgtaataaaacacttatattcactagtgcaaatggggtagaaggcttt
tttaaaaacggttttgatgcacctcattcatctgtgatttgtgtaggtggcaaaactgaa
agcaaacttgcagaaaaaggcatcaaaactctacatacggctaagaatgccgaagaatta
gcctcgtttatacttcaacagcaatgggataatcctgattttgttcacttttgtggcaac
cttgcattggatactttagaaaaaagcatcgctaatcacaatgcgaattatataaagaaa
atagtttacgaaaccgaacttctataccctactcttaacaaaaaatatgatgctttagtt
tttttagtccaagtggagttcgtagctttgtaa

DBGET integrated database retrieval system