KEGG   Riemerella anatipestifer RA-GD: RIA_1016Help
Entry
RIA_1016          CDS       T02007                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RIA_1016
Enzymes [BR:rar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RIA_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(994939..995727)
Genome map
AA seq 262 aa AA seqDB search
MGNFYSFNQFFRILKMSKIKSILISQPQPAESSPYLELAKKEKIEIDFRPFIYVQGADAK
DLRTQKIDLSKYTGIIFTSRNAIDHYFRLAEEMRFSVPDSMRYICQSEAIANYLQKHIVY
RKRKISFGEKLPTDIIPLLKKYPSEKYLLPSSDILNDGITKVLDESGVDWTRAIMYRTVN
SDLSDININGYDVLVFFSPQGIKSLVENFKDYKKSKFKVAVFGNSTKAEAEKAGLTVDIV
APTKENPSMTMALENFIKKANK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaatttttattcttttaatcaatttttcaggattttaaaaatgtcaaaaattaaa
tctattctaatatctcagcctcaacctgcggaatcatctccttatttagaacttgcgaaa
aaggaaaaaatagaaatagattttcgtccatttatttatgttcagggggcggatgctaag
gatttgagaacacaaaaaatagacctttctaagtatacaggaattatttttactagtaga
aacgcaatagatcactactttcgtttagctgaggagatgcgtttttcggtgccagattct
atgcgatacatttgccagtcagaggctatcgccaattatttgcaaaagcacattgtttac
agaaaaagaaaaattagttttggtgaaaaattacccactgatataatccctttgcttaag
aaatatccatcagagaagtatcttttaccctcttctgatattcttaatgatgggataacc
aaagttttagacgagtctggagtagattggactagggctattatgtatcgtaccgttaat
agcgatttgtctgatataaatatcaatggctatgatgttctagtgttttttagcccacaa
gggataaagtctttggtagaaaactttaaagattataaaaaatctaaatttaaagtagct
gtttttggtaattctactaaagcagaagcggaaaaagctgggctaacagtagatattgtg
gcgcctaccaaagaaaatccgtctatgacaatggcattagaaaacttcatcaaaaaagcc
aataagtag

DBGET integrated database retrieval system