KEGG   Riemerella anatipestifer RA-GD: RIA_1065Help
Entry
RIA_1065          CDS       T02007                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RIA_1065
Enzymes [BR:rar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RIA_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1042514..1043101
Genome map
AA seq 195 aa AA seqDB search
MFLENTINHAKQSGWMEVICGSMFSGKTEELIRRLRRAEMAGLNVEIFKPKLDTRYSEED
VVSHNRNKIRSTAVDTPNEILLLGSNCDVVGIDEAQFFDQGIVEVANQLANNGVRVVIAG
LDMDFKGRPFGPMPYLMATAEYVTKVHAICKRTGNLANYSMRTSTSQDLVELGETESYEA
VSRRVFVDEFLNKKS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatacaatcaatcacgcaaaacaaagtggatggatggaggtcatctgc
ggttctatgttctctggaaagactgaggaactcattcgtaggcttcgcagggcagaaatg
gcagggcttaatgtagagatttttaaacctaaacttgacactcgctactccgaggaagat
gtggtttctcacaacagaaataaaataagaagtacagcggtggatacgcctaacgaaatc
ttattactaggttctaattgtgatgtggtaggcatagatgaagctcagttttttgaccaa
ggcatcgtggaagtagccaaccaactagcaaacaacggagttagggtagtaattgcgggg
cttgatatggattttaaaggcagaccttttggacctatgccttaccttatggcaacagca
gaatatgttactaaagtacacgccatctgtaaaagaacaggcaaccttgctaattactct
atgagaacgtccactagccaagatttagtagaactaggtgaaaccgaaagctacgaggct
gtaagtagacgcgtttttgtagatgagtttttaaataagaaatcctaa

DBGET integrated database retrieval system