KEGG   Riemerella anatipestifer RA-GD: RIA_1501Help
Entry
RIA_1501          CDS       T02007                                 

Definition
Asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rar00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1506473..1508362
Genome map
AA seq 629 aa AA seqDB search
MCGINGLILKDINSDSAIKKLKIMNQRIFHRGPDEDGLFVEQTGQNVVGFAMRRLSIIDL
SNGKQPIFSEDRTKVIVFNGEIYNYQSLRKQLLSVGKTFKTNSDTEVILRLYEVYGKAAF
KMLDGMFAFSIYDKSINKIFIARDFFGEKPLYYQNSEKGLIWCSELKSLMSVSEEERVIS
KEGLNLYFQLTYIPAPFTIYEGIYKLEPNHFIEYDLVANEFRLEKIHIEGKFDKRDLSFD
DAKKELRDLVKESVLSRSISDVPLGTFLSGGVDSSIVTVCLAEEMEQKINTFSIGYDKKS
FDESDKSKIVAKQIGSIHHQFILKEQDLEDEITSVLQNFDEPFADSSALPSFFVAKKTSE
YVKVALTGDGGDEIFGGYNKYLIGKINERYTQIVPKALHCTIKKVSDFLTKQKEDQRGLK
FKVRKAVNAIDYGGEFYYNMVKLGFQEPELSRFLRKEWLVKDALSLYKERIPNPKTLNDF
RNVDRMISLEGDMIVKVDRTSMLTSLECRAPFLNKKLWDYSHTLPKHYLLNGNNKKYILK
KAFEDKFPEGFLEKSKKGFGVPVGDWLKSTLKEELMSYVVTEKLEKQGLFNVLEIQKLVY
NHLNEIEDNTFRVWTLYCFQKWYFNMHLE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattaatggacttattttaaaagatataaattctgattcagcgataaagaaa
ctgaagataatgaaccaacgaatttttcatcgtggaccagatgaagacggtctatttgtg
gagcaaacgggacaaaatgttgtagggtttgctatgcgtaggctctctattattgatttg
tctaatggtaagcaacctatattctcggaagataggactaaagttattgtttttaatggt
gaaatttataattatcaaagtttaagaaagcagcttttatccgtaggaaaaacctttaaa
acgaattctgataccgaagttatactaaggttatatgaagtttatgggaaagcagcattt
aaaatgttagatggaatgtttgctttttctatttatgataagtctattaacaagatattt
atagcaagagatttctttggggagaagcctctgtattatcagaattcagaaaaaggactt
atttggtgttcagaattaaaatctttgatgtcggtttcagaagaagaacgagttatttct
aaagaaggattaaatctttactttcagttgacttatatacccgcaccttttacgatttat
gagggaatttataagttagagcccaatcactttatagagtatgatttggttgcgaatgaa
tttagattagaaaaaatacatattgaaggtaaatttgataagagagacctttcatttgat
gacgctaagaaggaattgagggatttggtaaaggaaagtgttctttctagaagcatttca
gatgtccctttaggtacttttttgtctggtggagtagattcttctattgtaacggtttgt
ttagctgaagaaatggagcaaaagattaatactttttctattggctatgataaaaaatcg
tttgacgagtcagataaatcaaaaattgtggccaagcaaataggctctatacatcatcaa
tttatacttaaagaacaagatttagaagacgaaataacttctgtactacagaattttgac
gagccgtttgcggactcttctgcattgcctagtttttttgtggcaaaaaaaactagtgaa
tatgtaaaagtagctctgacaggagatggtggagatgaaatttttggaggatataataaa
tacctcatagggaaaataaatgaaaggtatacgcaaatagtgccaaaggctttgcattgt
acgattaaaaaggtatcagactttttaactaaacaaaaagaggatcagcgcggactgaag
tttaaagtgcgaaaagcagttaatgccattgactacgggggagagttttactataatatg
gttaagttaggttttcaagagcctgaactatcacgttttcttaggaaagaatggttagta
aaagatgctttgagtctttacaaagagagaatacctaatcctaaaacacttaacgatttt
cgtaatgtggatagaatgataagtttggaaggagatatgattgtaaaagtggataggaca
agtatgttgacttcgttggaatgtagggcgccctttttaaataaaaaactttgggattat
tctcacactcttccaaagcattatttgcttaatgggaataataaaaagtatatactaaag
aaggcttttgaggataaatttccagaaggttttttagagaaatcaaagaaaggttttggg
gtacctgttggggattggttaaaatctacacttaaagaggaattaatgtcttacgtagta
acagagaaattggagaaacaaggcctttttaatgttctagaaatccaaaaattagtttac
aatcatttaaatgaaatagaagataatacatttcgtgtttggacgctttactgctttcag
aagtggtattttaatatgcatttagagtaa

DBGET integrated database retrieval system