KEGG   Riemerella anatipestifer RA-GD: RIA_1512Help
Entry
RIA_1512          CDS       T02007                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rar00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rar00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1517600..1518091)
Genome map
AA seq 163 aa AA seqDB search
MTTIIVAMGKNNEIGFNNQLLWHLPKDLKHFKNLTSGHPIIMGRKTYESIGKPLPNRTNI
VVSQKKDWFEEGILIVGTLKEAIKFAKKIDENIFIIGGGSIYEQTIDQADRLEVTLVDTT
LKADTFFPKINPKEWLKTDEICHEKDEQNPYNFCFQTYERVQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcattgtagcaatgggtaaaaataatgaaataggctttaataaccaactt
ctttggcatttacctaaagatttgaaacacttcaaaaatttaacctcagggcaccctata
attatggggcgaaaaacctatgaaagcattggaaaacctctacccaacagaactaatatc
gtggttagtcaaaaaaaagattggtttgaggaaggtattctgattgttggtactttaaag
gaagctattaaatttgccaagaaaatagacgaaaatattttcatcatcggtggtggcagc
atttatgaacagaccatagaccaagcagaccgactggaagtaactttagtggataccact
ctaaaggcagatacctttttcccaaaaatcaacccaaaagaatggctaaaaactgatgaa
atttgccatgaaaaggacgagcaaaacccttataatttttgctttcaaacttatgaaaga
gtacagaaataa

DBGET integrated database retrieval system