KEGG   Riemerella anatipestifer RA-GD: RIA_1571Help
Entry
RIA_1571          CDS       T02007                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rar00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577282..1577848
Genome map
AA seq 188 aa AA seqDB search
MKKLFIFILSALALVQCSSKKREVQQDTSKLSKSIYDYKVESLDGGEINFADFKGKKILI
VNTASECGFTPQYEALEKLYQKYKDRLVVVGFPANNFGGQEPGTNTEIKTFCQVNYGVTF
PMAAKVSVKGEDIAPIFQFLTKKELNGVKDTTILWNFTKFLLDENGKIIESYLSTTKPDS
EAITKHLK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctttatattcatactttccgcactcgctttagtgcaatgttctagtaaa
aaaagagaggttcaacaggatacatctaagctttctaaaagtatctacgattataaagtg
gaaagtttagacggtggagaaattaattttgcggatttcaaaggcaaaaaaatacttatt
gtaaatacagcgtctgagtgtggttttacacctcagtatgaagccttggaaaagctctat
caaaaatataaagataggctagtggtagtaggcttccctgctaataactttggaggacaa
gagccaggaactaataccgagattaaaactttttgtcaagtgaactatggagtaactttt
cctatggcagctaaggtttctgtgaaaggagaagatatagcacctatttttcagtttctt
actaaaaaggaattaaacggagttaaagataccaccatactttggaattttaccaaattt
cttctagacgaaaacggaaaaataatagaaagctatctaagtactactaagcctgatagc
gaagcgattacaaaacatttaaaataa

DBGET integrated database retrieval system