KEGG   Riemerella anatipestifer RA-GD: RIA_1621Help
Entry
RIA_1621          CDS       T02007                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RIA_1621
Enzymes [BR:rar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RIA_1621
Exosome [BR:rar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RIA_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1622785..1623777
Genome map
AA seq 330 aa AA seqDB search
MIIYSRNRRLRRNDSLRSLVRENHLSTSDFVMPMFVMEGEKKQEAIPSMPGIYRRSIDLT
VEECKELFALGVKAVNIYMKVSDHLKDNAGTEAWNPNGLMQNTIRAIKEAVPEMVVMPDV
ALDPYSIYGHDGIVTNGEVDNDATVEALVKMSISQAEAGADIVAPSDMMDGRVMAIREGL
EENGFHNVGILSYAAKYASSFYGPFRSALDSAPKETANIPKDKKTYQMDFHNTREAINEV
IRDVEEGADIIMIKPGMPYLDIVSKVRELIDIPIAVYQVSGEYAMLKAASQNGWLDNDKV
LIESLTCFKRAGADMIFTYAAKEAAMLLQK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattatatattcaagaaatagaagattaagacgaaatgacagccttagaagtcttgta
agagagaaccatctttcaacatctgattttgtaatgcctatgtttgtgatggaaggagaa
aagaaacaagaggctatcccttctatgcctggtatctatcgcagaagtatagatttaacg
gtagaagaatgtaaagagctattcgctttgggtgtgaaagcagttaatatctatatgaag
gtttcagaccatctcaaagataatgcaggaacagaagcatggaatcctaatgggttgatg
caaaacaccataagagctattaaagaagctgttccagaaatggtagtgatgcctgatgta
gctttagacccttattctatctacggacacgatggtattgtaactaatggtgaagtggat
aatgatgctacagtggaagctttggttaagatgtctatttctcaagctgaagctggagcg
gatattgtagcaccaagtgatatgatggacggcagagtaatggctataagagaaggatta
gaggaaaatgggtttcataatgtaggtattttgtcttatgcggcgaaatatgcaagttct
ttctatggacctttcagaagtgcgttggatagtgctccgaaggaaaccgcaaacattccg
aaggataaaaaaacttatcaaatggattttcataatactagagaagctataaatgaagtg
attagagatgtagaggaaggagctgatattattatgataaagccaggtatgccttattta
gacattgtttctaaagttagagagctaatagatattcctattgcggtgtatcaagtaagt
ggagaatatgccatgctaaaagctgcttcgcagaatggttggctagacaatgataaagtc
ttaatagaaagtcttacttgctttaagagagctggggctgatatgattttcacctatgca
gcaaaagaagccgcaatgcttctacaaaaataa

DBGET integrated database retrieval system