KEGG   Riemerella anatipestifer RA-GD: RIA_1658Help
Entry
RIA_1658          CDS       T02007                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIA_1658
   01230 Biosynthesis of amino acids
    RIA_1658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_1658
   00030 Pentose phosphate pathway
    RIA_1658
   00051 Fructose and mannose metabolism
    RIA_1658
   00052 Galactose metabolism
    RIA_1658
  Energy metabolism
   00680 Methane metabolism
    RIA_1658
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RIA_1658
Enzymes [BR:rar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RIA_1658
Protein phosphatases and associated proteins [BR:rar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RIA_1658
Messenger RNA biogenesis [BR:rar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RIA_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1668312..1669298
Genome map
AA seq 328 aa AA seqDB search
MSESKLKRIGVLTSGGDSPGMNAAIRAVVRTAHYYGIECMGIREGYNGLIEGNMIKMGPR
SVKNIINQGGTILKSARSKEFRTVEGRLKAFEQCQKNEIGALVCIGGDGTFTGAKVFSEE
YGIKVVGVPGTIDNDIFGTDFTIGYDTALNTAVEAIDKIRDTATSHNRVFFVEVMGRDAG
FIALNSGIASGAIDILIPERKDSLEEMFENFHNAQKRGKTSSIVVVAEGEQLASTYELAE
KTQKEFPDYDIRVAILGHIQRGGMPSCADRVLASRLGYGAVEGLRKGLTNVMAGIRANQL
VFTPIEDAIKKHNEINQDLLKISEILAM
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatcaaagttgaaaaggataggggttcttacttctggaggggattctccaggt
atgaatgcggcgataagggcagtggtaagaacagctcattattatggtatagaatgtatg
gggattagagaagggtacaatgggcttatagaagggaacatgattaaaatgggacctaga
tctgttaagaatattattaaccaaggtggtacaattctaaaatcagcaaggtctaaagag
tttagaacagtagaggggagattaaaggcttttgaacaatgccaaaagaatgaaatagga
gctttggtttgtattggtggagatggtacttttacaggagcaaaagttttcagcgaagag
tatggtatcaaggtggtgggtgtacctggaactattgataatgatatcttcggtactgat
tttacgataggatatgacacagctcttaacaccgcggtggaagctatagacaaaataaga
gatacggcaacctctcataacagagtgttttttgtggaagtgatggggagagatgcaggt
tttatagcacttaatagcggtattgcttcaggagctatagatattttgataccagagaga
aaggatagtctagaggaaatgtttgagaatttccataatgctcaaaaacgaggtaaaaca
tcgtctattgtagtagtagcagagggggagcagttggcttctacctatgagttagccgag
aaaactcaaaaagaattccctgattatgatatcagagtggctattctagggcatatccaa
agaggcggaatgcctagctgtgctgatagagtattggcgagtagattaggttatggagca
gtagaagggcttagaaaaggtcttactaatgtgatggcaggtataagagccaatcagcta
gtttttactccaatagaagatgctattaaaaagcacaacgaaatcaatcaagatttactg
aagatatcagaaattttggcgatgtaa

DBGET integrated database retrieval system