KEGG   Riemerella anatipestifer RA-GD: RIA_1658Help
Entry
RIA_1658          CDS       T02007                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00010  Glycolysis / Gluconeogenesis
rar00030  Pentose phosphate pathway
rar00051  Fructose and mannose metabolism
rar00052  Galactose metabolism
rar00680  Methane metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
rar01230  Biosynthesis of amino acids
rar03018  RNA degradation
Module
rar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_1658
   00030 Pentose phosphate pathway
    RIA_1658
   00051 Fructose and mannose metabolism
    RIA_1658
   00052 Galactose metabolism
    RIA_1658
  Energy metabolism
   00680 Methane metabolism
    RIA_1658
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RIA_1658
Enzymes [BR:rar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RIA_1658
Protein phosphatases and associated proteins [BR:rar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RIA_1658
Messenger RNA biogenesis [BR:rar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RIA_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Tex_YqgF
Motif
Other DBs
NCBI-ProteinID: ADZ12741
Position
1668312..1669298
Genome map
AA seq 328 aa AA seqDB search
MSESKLKRIGVLTSGGDSPGMNAAIRAVVRTAHYYGIECMGIREGYNGLIEGNMIKMGPR
SVKNIINQGGTILKSARSKEFRTVEGRLKAFEQCQKNEIGALVCIGGDGTFTGAKVFSEE
YGIKVVGVPGTIDNDIFGTDFTIGYDTALNTAVEAIDKIRDTATSHNRVFFVEVMGRDAG
FIALNSGIASGAIDILIPERKDSLEEMFENFHNAQKRGKTSSIVVVAEGEQLASTYELAE
KTQKEFPDYDIRVAILGHIQRGGMPSCADRVLASRLGYGAVEGLRKGLTNVMAGIRANQL
VFTPIEDAIKKHNEINQDLLKISEILAM
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatcaaagttgaaaaggataggggttcttacttctggaggggattctccaggt
atgaatgcggcgataagggcagtggtaagaacagctcattattatggtatagaatgtatg
gggattagagaagggtacaatgggcttatagaagggaacatgattaaaatgggacctaga
tctgttaagaatattattaaccaaggtggtacaattctaaaatcagcaaggtctaaagag
tttagaacagtagaggggagattaaaggcttttgaacaatgccaaaagaatgaaatagga
gctttggtttgtattggtggagatggtacttttacaggagcaaaagttttcagcgaagag
tatggtatcaaggtggtgggtgtacctggaactattgataatgatatcttcggtactgat
tttacgataggatatgacacagctcttaacaccgcggtggaagctatagacaaaataaga
gatacggcaacctctcataacagagtgttttttgtggaagtgatggggagagatgcaggt
tttatagcacttaatagcggtattgcttcaggagctatagatattttgataccagagaga
aaggatagtctagaggaaatgtttgagaatttccataatgctcaaaaacgaggtaaaaca
tcgtctattgtagtagtagcagagggggagcagttggcttctacctatgagttagccgag
aaaactcaaaaagaattccctgattatgatatcagagtggctattctagggcatatccaa
agaggcggaatgcctagctgtgctgatagagtattggcgagtagattaggttatggagca
gtagaagggcttagaaaaggtcttactaatgtgatggcaggtataagagccaatcagcta
gtttttactccaatagaagatgctattaaaaagcacaacgaaatcaatcaagatttactg
aagatatcagaaattttggcgatgtaa

DBGET integrated database retrieval system