KEGG   Riemerella anatipestifer RA-GD: RIA_1679Help
Entry
RIA_1679          CDS       T02007                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690003..1690332
Genome map
AA seq 109 aa AA seqDB search
MLETEPVEFVSSNNFCNIALSLETDFSPIQILKKAKEIERYMGRVLDSRDLGGYEDRVID
VDIVAIGNLSYQSKMLNLPHHRHLFVRNFSRKILEDLGENIEKYKNIQI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaacagagcctgtggagtttgttagttctaataatttttgtaatattgcactc
tcgttggagactgatttttcgcctattcaaattttgaagaaagcaaaagaaatagaaagg
tatatgggaagggttcttgattctagggatttgggaggttatgaagatagagttatagat
gttgatatagttgccataggcaatctttcgtatcagtcaaaaatgttaaatttaccccat
cataggcatctttttgtgcgtaatttttctaggaaaattctagaagatttgggagagaat
attgaaaaatataaaaacattcaaatatga

DBGET integrated database retrieval system