KEGG   Riemerella anatipestifer RA-GD: RIA_1826Help
Entry
RIA_1826          CDS       T02007                                 

Definition
Aspartate carbamoyltransferase, catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RIA_1826
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RIA_1826
Enzymes [BR:rar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RIA_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821968..1822864
Genome map
AA seq 298 aa AA seqDB search
MLTISDLSTEKIMSLLEEAQGFTNGKIAKCQQEVYVSNLFFENSTRTKTSFDVAERKLGF
NVVPFDVSTSSVNKGETLYDTVKTLESIGVDLVVIRHSQDFYFRELETINIPIINGGDGT
GNHPSQSLLDLMTIYQEFKKFEGLKVGIVGDVKHSRVANSNAEALRRLGAKVYFSGPEDW
FDEAEFINGTYLPIDTLVKEVDVVMLLRIQHERHGEKMKLSLDKYHQKYGLTKERATQMK
PTTIIMHPAPINRGVEIDTDLVESPQSRIFKQMENGVYARMAILKQALEDKGIKFKTM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaatttcagatttatctacagagaaaattatgtctcttttagaagaggctcaa
gggtttactaatggtaaaatagccaagtgccaacaagaagtttatgtgtctaatcttttc
tttgaaaatagtacgagaaccaaaacaagttttgatgtagccgaaaggaaattgggattt
aatgttgttccttttgatgtatctacaagttcggtaaacaaaggagaaaccctttacgat
acggtaaaaactttggagagtattggagttgatttagtggtcattcgtcatagtcaggac
ttttattttagggagttggaaactattaacattcctataattaacggaggagatggcaca
ggcaatcacccttcgcaatctttgttggatttgatgacgatttatcaagaatttaaaaag
tttgaaggattaaaagtggggattgtaggcgatgttaaacacagcagggtggctaattct
aacgcagaggcactcagaaggctcggagctaaagtctatttttctggaccagaagattgg
tttgatgaagccgaatttatcaacgggacttatctgcctatagatacacttgtaaaagag
gtagatgtagtgatgcttcttcgcattcagcacgaaagacatggggagaaaatgaaatta
tctttagataaataccatcaaaaatatggtcttactaaagaaagagccactcaaatgaaa
ccaactactatcattatgcatccagctcctatcaatagaggagtggagatagatacggat
ttggtggaaagtcctcaatccagaatatttaagcaaatggagaatggtgtttacgcccga
atggcaatcctaaaacaggctttagaagacaaaggtattaagtttaaaacaatgtaa

DBGET integrated database retrieval system