KEGG   Riemerella anatipestifer RA-GD: RIA_1929Help
Entry
RIA_1929          CDS       T02007                                 

Definition
Amidases, nicotinamidase-like protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rar00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1933390..1933995)
Genome map
AA seq 201 aa AA seqDB search
MKKALIVVDVQNDFCEGGALAVPNANEIIPYINLLIEENQYDKIIFTQDWHPANHKSFAS
NNDKKVGETISLNGVPQFMWPDHCVENSFGAEFHKDLDISKVDYIVKKGKNPEIDSYSAF
QDNNHFMKTGLADYLKENDIQLVEIVGLALDYCVKYTCLDAVKEGFLTCLHFNGTRAVNV
KPENGRDAIYEMLENGVTILG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcacttatcgtggtagatgttcaaaatgatttctgtgaaggaggagctttg
gctgtacctaacgctaatgaaattatcccttacatcaaccttttaattgaggaaaaccaa
tatgataaaataattttcacacaagattggcaccctgcaaatcacaaatcatttgcatct
aataatgataaaaaagtaggtgaaactatatcactgaacggcgttccacaatttatgtgg
ccagatcattgtgtagaaaattcttttggtgcagaattccataaagacctagatattagt
aaagtagattacattgtaaaaaaaggtaaaaaccctgaaatagatagttatagtgctttt
caggacaataatcattttatgaaaacggggttagctgactatcttaaagaaaacgatata
caattagtagaaattgttggcttagcactagattattgcgttaaatatacttgtttagat
gctgttaaagaaggattcttaacctgtttacactttaatggtactcgtgctgtaaatgta
aaacctgaaaacggaagagatgccatctacgaaatgttagaaaatggtgttaccatttta
ggttaa

DBGET integrated database retrieval system