KEGG   Riemerella anatipestifer RA-GD: RIA_1929Help
Entry
RIA_1929          CDS       T02007                                 

Definition
Amidases, nicotinamidase-like protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RIA_1929
Enzymes [BR:rar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RIA_1929
    3.5.1.-  
     RIA_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1933390..1933995)
Genome map
AA seq 201 aa AA seqDB search
MKKALIVVDVQNDFCEGGALAVPNANEIIPYINLLIEENQYDKIIFTQDWHPANHKSFAS
NNDKKVGETISLNGVPQFMWPDHCVENSFGAEFHKDLDISKVDYIVKKGKNPEIDSYSAF
QDNNHFMKTGLADYLKENDIQLVEIVGLALDYCVKYTCLDAVKEGFLTCLHFNGTRAVNV
KPENGRDAIYEMLENGVTILG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcacttatcgtggtagatgttcaaaatgatttctgtgaaggaggagctttg
gctgtacctaacgctaatgaaattatcccttacatcaaccttttaattgaggaaaaccaa
tatgataaaataattttcacacaagattggcaccctgcaaatcacaaatcatttgcatct
aataatgataaaaaagtaggtgaaactatatcactgaacggcgttccacaatttatgtgg
ccagatcattgtgtagaaaattcttttggtgcagaattccataaagacctagatattagt
aaagtagattacattgtaaaaaaaggtaaaaaccctgaaatagatagttatagtgctttt
caggacaataatcattttatgaaaacggggttagctgactatcttaaagaaaacgatata
caattagtagaaattgttggcttagcactagattattgcgttaaatatacttgtttagat
gctgttaaagaaggattcttaacctgtttacactttaatggtactcgtgctgtaaatgta
aaacctgaaaacggaagagatgccatctacgaaatgttagaaaatggtgttaccatttta
ggttaa

DBGET integrated database retrieval system