KEGG   Riemerella anatipestifer RA-GD: RIA_1947Help
Entry
RIA_1947          CDS       T02007                                 

Definition
Protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rar  Riemerella anatipestifer RA-GD
Brite
Enzymes [BR:rar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RIA_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947288..1947818
Genome map
AA seq 176 aa AA seqDB search
MESVFEDYAYEDRAFPIAAHQTISHPSTVAEQTELLQVEKGEKILEIGTGSGYQAAVLMV
MGAKVYTIERQKKLFDFSKKMFKILGLRPHFQSFGDGFLGLPTFAPFDKIIVTCGAETLP
VELLKQLKVGGKMVIPLGALEEQILYRFTKISETEIEKETFGVYKFVPMLGDTDGV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagtgtttttgaggattatgcctacgaagatagagcatttcctattgctgcacat
caaacgatttctcacccttctactgtggctgagcaaacagaattattacaggtagagaaa
ggagaaaaaatattagaaataggcacaggtagcggctatcaagcagcagttcttatggtg
atgggagcgaaagtttacactattgaaagacagaaaaagctatttgatttttctaaaaag
atgtttaaaattttgggacttcgtccacattttcaaagttttggagatggttttttaggg
ttgcctacttttgcaccatttgataaaattattgtaacctgcggagctgaaactttgcct
gtagagttattaaagcaacttaaagtaggtggtaaaatggtcattccgctaggggcttta
gaagagcaaatactttatagatttaccaaaatttctgaaacagaaatagaaaaggaaact
tttggagtgtataagtttgttccaatgttgggagatacggatggcgtttaa

DBGET integrated database retrieval system