KEGG   Riemerella anatipestifer RA-GD: RIA_2020Help
Entry
RIA_2020          CDS       T02007                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIA_2020
   01230 Biosynthesis of amino acids
    RIA_2020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_2020
   00051 Fructose and mannose metabolism
    RIA_2020
   00562 Inositol phosphate metabolism
    RIA_2020
Enzymes [BR:rar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RIA_2020
Exosome [BR:rar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RIA_2020
  Exosomal proteins of bladder cancer cells
   RIA_2020
  Exosomal proteins of melanoma cells
   RIA_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2018203..2018958
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKDFSEAQALMQQLSEYTSTHTPNCKVMIAPPALYLTTAKDIFKNKEV
EVYAQDISEHESGAYTGEISAAMIASVNLDGSIIAHSERRQYHGETDSHANRKVKALLDK
GLTPIYCNGENLEERKSGKYLEVIKNQTQTALFTLSAEEIKKVVIAYEPVWAIGTGETAT
AEQAQEVHAFIRNMIAEKYGKEVADEVSILYGGSVKPSNAKEIFSQPDVDGGLIGGAALN
IEDFSKIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgtagcaggaaactggaaaatgaataaagatttttcggaagctcaa
gcacttatgcaacagctatccgagtatactagcacacatacacctaactgcaaggtaatg
atagcgccgccagctctttatcttaccacagctaaagatatttttaaaaataaagaggta
gaagtatatgctcaggatatttccgaacacgaatctggagcttacacaggagaaatctcg
gctgctatgatagcttctgtaaatttagatgggagcattattgctcactctgaacgcaga
caataccacggagaaaccgatagccatgctaatagaaaagtaaaagctttattagataaa
gggcttacacctatctactgtaatggcgaaaatttggaagaaagaaagtctggtaagtat
ttagaagtgattaaaaaccaaacacaaacagctttgtttactctaagtgctgaagaaata
aagaaagtggttatagcttacgaacctgtatgggcaataggtactggagaaactgccact
gcagaacaagcacaagaggtgcacgcttttattagaaatatgatagcagaaaaatatggc
aaggaggtggcagatgaagtatctatcctttatggaggttctgtaaagccaagtaatgct
aaagaaattttctctcagcctgatgtagatggtggtcttataggtggtgcagctttgaat
atagaagacttctcaaaaataatagaggctttctaa

DBGET integrated database retrieval system