KEGG   Riemerella anatipestifer RA-GD: RIA_2020Help
Entry
RIA_2020          CDS       T02007                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00010  Glycolysis / Gluconeogenesis
rar00051  Fructose and mannose metabolism
rar00562  Inositol phosphate metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
rar01230  Biosynthesis of amino acids
Module
rar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rar_M00002  Glycolysis, core module involving three-carbon compounds
rar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_2020
   00051 Fructose and mannose metabolism
    RIA_2020
   00562 Inositol phosphate metabolism
    RIA_2020
Enzymes [BR:rar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RIA_2020
Exosome [BR:rar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RIA_2020
  Exosomal proteins of bladder cancer cells
   RIA_2020
  Exosomal proteins of melanoma cells
   RIA_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM G_glu_transpept DUF4128
Motif
Other DBs
NCBI-ProteinID: ADZ13066
Position
2018203..2018958
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKDFSEAQALMQQLSEYTSTHTPNCKVMIAPPALYLTTAKDIFKNKEV
EVYAQDISEHESGAYTGEISAAMIASVNLDGSIIAHSERRQYHGETDSHANRKVKALLDK
GLTPIYCNGENLEERKSGKYLEVIKNQTQTALFTLSAEEIKKVVIAYEPVWAIGTGETAT
AEQAQEVHAFIRNMIAEKYGKEVADEVSILYGGSVKPSNAKEIFSQPDVDGGLIGGAALN
IEDFSKIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgtagcaggaaactggaaaatgaataaagatttttcggaagctcaa
gcacttatgcaacagctatccgagtatactagcacacatacacctaactgcaaggtaatg
atagcgccgccagctctttatcttaccacagctaaagatatttttaaaaataaagaggta
gaagtatatgctcaggatatttccgaacacgaatctggagcttacacaggagaaatctcg
gctgctatgatagcttctgtaaatttagatgggagcattattgctcactctgaacgcaga
caataccacggagaaaccgatagccatgctaatagaaaagtaaaagctttattagataaa
gggcttacacctatctactgtaatggcgaaaatttggaagaaagaaagtctggtaagtat
ttagaagtgattaaaaaccaaacacaaacagctttgtttactctaagtgctgaagaaata
aagaaagtggttatagcttacgaacctgtatgggcaataggtactggagaaactgccact
gcagaacaagcacaagaggtgcacgcttttattagaaatatgatagcagaaaaatatggc
aaggaggtggcagatgaagtatctatcctttatggaggttctgtaaagccaagtaatgct
aaagaaattttctctcagcctgatgtagatggtggtcttataggtggtgcagctttgaat
atagaagacttctcaaaaataatagaggctttctaa

DBGET integrated database retrieval system