KEGG   Riemerella anatipestifer RA-GD: RIA_2020Help
Entry
RIA_2020          CDS       T02007                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIA_2020
   01230 Biosynthesis of amino acids
    RIA_2020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_2020
   00051 Fructose and mannose metabolism
    RIA_2020
   00562 Inositol phosphate metabolism
    RIA_2020
Enzymes [BR:rar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RIA_2020
Exosome [BR:rar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RIA_2020
  Exosomal proteins of bladder cancer cells
   RIA_2020
  Exosomal proteins of melanoma cells
   RIA_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2018203..2018958
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKDFSEAQALMQQLSEYTSTHTPNCKVMIAPPALYLTTAKDIFKNKEV
EVYAQDISEHESGAYTGEISAAMIASVNLDGSIIAHSERRQYHGETDSHANRKVKALLDK
GLTPIYCNGENLEERKSGKYLEVIKNQTQTALFTLSAEEIKKVVIAYEPVWAIGTGETAT
AEQAQEVHAFIRNMIAEKYGKEVADEVSILYGGSVKPSNAKEIFSQPDVDGGLIGGAALN
IEDFSKIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgtagcaggaaactggaaaatgaataaagatttttcggaagctcaa
gcacttatgcaacagctatccgagtatactagcacacatacacctaactgcaaggtaatg
atagcgccgccagctctttatcttaccacagctaaagatatttttaaaaataaagaggta
gaagtatatgctcaggatatttccgaacacgaatctggagcttacacaggagaaatctcg
gctgctatgatagcttctgtaaatttagatgggagcattattgctcactctgaacgcaga
caataccacggagaaaccgatagccatgctaatagaaaagtaaaagctttattagataaa
gggcttacacctatctactgtaatggcgaaaatttggaagaaagaaagtctggtaagtat
ttagaagtgattaaaaaccaaacacaaacagctttgtttactctaagtgctgaagaaata
aagaaagtggttatagcttacgaacctgtatgggcaataggtactggagaaactgccact
gcagaacaagcacaagaggtgcacgcttttattagaaatatgatagcagaaaaatatggc
aaggaggtggcagatgaagtatctatcctttatggaggttctgtaaagccaagtaatgct
aaagaaattttctctcagcctgatgtagatggtggtcttataggtggtgcagctttgaat
atagaagacttctcaaaaataatagaggctttctaa

DBGET integrated database retrieval system