KEGG   Riemerella anatipestifer RA-GD: RIA_2053Help
Entry
RIA_2053          CDS       T02007                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RIA_2053
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RIA_2053
Enzymes [BR:rar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RIA_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2047956..2048732
Genome map
AA seq 258 aa AA seqDB search
MTILDKIVDCKLDEIQQAKKQTPLEKLKDTPFFYQPTRGFIESLKSNPYGIIAEFKRKSP
SKNNINIEAKIQAILPLYKAYGAACVSVLTDTPFFGGSLTDLEEANAYDIPLLRKDFIVD
DYQIYQAKAHGADCILLIANILSKSQIEDLTDTAHHLGLDVLLEFYSGEDFDKYYSKLKM
VGINNRNLNTFEVDYEHAIRMRNQLPEDTLSVAESAIYSPEIYKKLKNNGFEAFLMGEYF
MKQDHVGAALQSFIEEIK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttagacaaaatagtagattgtaagctggacgaaattcagcaagccaaaaag
cagacgccgttagaaaaactcaaggacactccgtttttctatcagcctacacgaggtttt
attgagagtttaaaatccaatccgtatggaattatagccgagtttaaaaggaaatcgccc
tctaaaaacaacatcaacatagaggctaaaatccaagcgattttaccgctatataaggca
tacggagcggcttgtgtgtctgtattgacggatacgcctttcttcgggggaagtttaacc
gatttggaagaagccaatgcttacgatatacctttgctaaggaaagactttattgtcgat
gattatcaaatttaccaagccaaagctcatggtgcagactgtattttacttatagccaac
attttgtctaaatcccagattgaagaccttacagatacagcacaccacttgggattagat
gtcttgttagaattttatagtggtgaagattttgataaatactattccaaattaaaaatg
gtaggcattaacaaccgaaacctcaatacttttgaagtggattacgagcacgccattaga
atgcgaaaccaattgcctgaagacactttaagcgttgccgaaagtgccatttatagtcct
gaaatttataaaaaactaaaaaacaatggttttgaggcttttttaatgggcgaatatttt
atgaagcaagaccatgttggagcggctttacaatcttttattgaagaaataaaataa

DBGET integrated database retrieval system