KEGG   Riemerella anatipestifer RA-GD: RIA_2057Help
Entry
RIA_2057          CDS       T02007                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00260  Glycine, serine and threonine metabolism
rar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01130  Biosynthesis of antibiotics
rar01230  Biosynthesis of amino acids
Module
rar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RIA_2057
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RIA_2057
Enzymes [BR:rar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RIA_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ADZ13100
Position
2050885..2051619
Genome map
AA seq 244 aa AA seqDB search
MKKLNIYFTAGIPQLEDTAEIIKIIQEAGADMMEIGMPYSDPVADGEVIQQAHIKALENG
MSIEKLFEQLAKIKGEICIPIILMGYINPVLSYGFEKFCQKCQETGVNGLIIPDLPPIEF
EKKYQSILKKFNLNFTFLVTPETSDERILYLDSLSSGFLYAVSSSSTTGNQSKTLKNEDY
LNRLASLPLKNPLMIGFGIKNKNDFTTVTEQADGGIIGTVFVKILLEESNWKEKAKHFIQ
SIKS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatatatactttacagcaggtattcctcagctggaagatactgcggaa
atcattaaaataattcaagaagctggggctgatatgatggagattggtatgccttatagc
gatcctgttgccgatggtgaggtgatacaacaagctcacattaaagccttagaaaacgga
atgtcaatagagaaactctttgaacaattggcaaaaattaagggcgaaatttgcattcca
atcattttgatgggctacatcaatcctgtgctttcttatggctttgaaaagttttgtcag
aaatgccaagaaacaggcgttaatggattgattatccctgacctccctcctattgagttt
gaaaaaaaataccaatccattctcaaaaagtttaatctaaactttacctttttagtaaca
ccagaaacatctgatgaacgaattttgtatttggatagcttaagttctggatttttgtat
gccgtgagttcctcgtccacaacgggcaaccagtccaaaacattgaaaaacgaagattac
cttaaccgattagcctcattaccactgaaaaatccactaatgataggctttgggattaaa
aataaaaacgactttaccacagttaccgaacaagccgatggcggtattatagggactgta
tttgtgaaaattcttttagaagaatcgaattggaaagaaaaagctaaacattttatacaa
agtattaaatcttag

DBGET integrated database retrieval system