KEGG   Riemerella anatipestifer RA-GD: RIA_2088Help
Entry
RIA_2088          CDS       T02007                                 

Definition
Recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rar03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087740..2088348)
Genome map
AA seq 202 aa AA seqDB search
MNFPSKVLEKAVEEISGLPGIGRKSALRLALHLLRQPSSQGLALGDAIQNLVTEIKYCKE
CHNFSDTDICEICADDSRHAELLCVVEDVRDVMAIENTGKFKGKYLVLGGKISPMEGIGP
QQLNIETLESKLEIGEIEEVIFALSATMEGDTTVYYLYKKFKHFDIKFSNIARGISVGDE
LEYADEVSLGRSILNRIPYKGH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaagtaaggttttagaaaaagcagtagaagaaatatcaggtctcccaggg
ataggcagaaagtcggctctcagactagcgcttcatttgcttagacaaccgagttcacaa
ggattagctctaggcgatgctatacaaaatctagttacagagataaaatattgtaaagaa
tgccataacttttcggacacagatatttgcgaaatttgtgcagatgacagtagacacgct
gaactcctatgcgttgtggaagatgtgagagatgtaatggcgatagaaaacacaggaaaa
ttcaaaggaaaatatttggttttaggaggaaaaatatcgcctatggaaggtattggacct
caacaattaaatatagaaactttagaaagcaaactagaaataggggagatagaggaggtt
atttttgcactatctgccactatggagggcgataccaccgtgtattatttgtataaaaag
tttaagcattttgacattaaattctccaatattgcgagagggatttccgtaggagatgaa
ctagagtacgccgatgaagtttctttggggaggtctattttgaaccgaataccttataaa
ggtcattaa

DBGET integrated database retrieval system