KEGG   Rickettsia australis: MC5_02625Help
Entry
MC5_02625         CDS       T01783                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rau  Rickettsia australis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rau03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472372..473202)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETLKSSLKDKLIGLVIENVEFKRDNLRYKLSPLLATEILNTNILDVRRRAKYL
IIDFNNDYSLIVHLGMSGRLTLQSANYKTQKHDHVIFNLKNSEKLIFNDTRRFGMIYHLK
TNFLEKEFFTNLGIEPLSDLLTLGYLKSKLITQRIPIKNLIMDTRVIVGVGNIYASESLH
LARIHPDKLGSNLRDDEIESLIKSIREVLTKAITAGGTTIKDFVNSDNKPGYFTQQLTVY
GREGQSCLHCSDNITKAKHSGRSTFYCKTCQYNEYA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacttcctgaagtagaaactcttaaaagctccctgaaagataagctaattggg
cttgttatagaaaatgtagagttcaaaagagataatttacgttataaactatccccgctt
ttagctacagaaatcttaaatactaatatacttgatgttaggcgtcgtgcaaaatattta
attatagattttaataatgattattccttaatcgttcacctaggcatgagtggtagattg
actctgcaatctgctaattataaaactcaaaaacatgatcatgtaatttttaatttaaaa
aactccgaaaagctaattttcaatgatactagacgctttggaatgatttatcatttaaaa
actaacttcttggaaaaagaattttttactaatttaggaatagagccgctttctgattta
ttaacactgggatatttaaaaagcaaattaattactcaaagaataccaataaaaaacttg
attatggatacgagagttatagtcggagtcggcaatatttacgcttcagaaagtcttcat
ttagctagaattcatccggataaattaggtagcaatttaagggatgatgaaatagaaagt
ttaattaaatcaattagagaggtgctaactaaagctataactgccggcggtactactatt
aaagattttgtaaacagcgataacaaacctggttactttactcagcaacttacggtttac
ggcagagaaggacaaagttgtttacactgctccgataatattaccaaagcaaaacattca
ggcaggagtactttttattgtaaaacctgtcaatataatgaatatgcttga

DBGET integrated database retrieval system