KEGG   Rickettsia australis: MC5_03205Help
Entry
MC5_03205         CDS       T01783                                 

Gene name
rplT
Definition
50S ribosomal protein L20
Orthology
K02887  
large subunit ribosomal protein L20
Organism
rau  Rickettsia australis
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rau00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MC5_03205 (rplT)
Ribosome [BR:rau03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    MC5_03205 (rplT)
  Bacteria
    MC5_03205 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(565757..566110)
Genome map
AA seq 117 aa AA seqDB search
MTRAKSGTISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL
WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAKLAVNNSDGFASIVEKAKAHI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgcaaaatcaggaacaatttccaaaaatcgacataaaaaaatcctcaaatta
gccaaaggttatagaggtagagctaatagctgctttagagtagctattgaaaaggtagaa
aaagctctccaatatgcttatagagatcgtagaaatcgcaagcgtgattttagaggctta
tggattcaaagaataaatgcagcagtaagagaacatgggcttgtttactctcagtttatg
ggagctcttaaaaaagcagaaatcgatatagatcgtaaagtactggcaaaacttgccgtc
aataacagtgacggattcgcaagtatcgtagaaaaagcaaaagcacatatttaa

DBGET integrated database retrieval system