KEGG   Rickettsia australis: MC5_03205Help
Entry
MC5_03205         CDS       T01783                                 

Gene name
rplT
Definition
(GenBank) 50S ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
rau  Rickettsia australis
Pathway
rau03010  Ribosome
Module
rau_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rau00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MC5_03205 (rplT)
Ribosome [BR:rau03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MC5_03205 (rplT)
  Bacteria
    MC5_03205 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L20
Motif
Other DBs
NCBI-ProteinID: AFC70989
UniProt: H8K6U6
Position
complement(565757..566110)
Genome map
AA seq 117 aa AA seqDB search
MTRAKSGTISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL
WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAKLAVNNSDGFASIVEKAKAHI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgcaaaatcaggaacaatttccaaaaatcgacataaaaaaatcctcaaatta
gccaaaggttatagaggtagagctaatagctgctttagagtagctattgaaaaggtagaa
aaagctctccaatatgcttatagagatcgtagaaatcgcaagcgtgattttagaggctta
tggattcaaagaataaatgcagcagtaagagaacatgggcttgtttactctcagtttatg
ggagctcttaaaaaagcagaaatcgatatagatcgtaaagtactggcaaaacttgccgtc
aataacagtgacggattcgcaagtatcgtagaaaaagcaaaagcacatatttaa

DBGET integrated database retrieval system