KEGG   Rickettsia australis: MC5_03305Help
Entry
MC5_03305         CDS       T01783                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rau  Rickettsia australis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rau00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582071..583513
Genome map
AA seq 480 aa AA seqDB search
MSYNLKQLFQQYKVKGLSINSKTVKENDVFFAIKGQNVDGNDFINDALNQAAALVITDNE
KSATIDKIIYVEDVQAALYEAIEIFYPKKPKHLIAVTGTNGKSSVVSYIAQTYSLLGKKA
ASIGTIGVEIFGYDNLINDMPELTTLDYLSFRKIAHNLAENNIEYLAFEASSHGINQARL
GEIKVNIACFTSFSQDHLDYHYTKENYLLAKLKLFTEHLLQSGLAILNSDIEEIEFIKDY
LCNHNIKFITVGKEGDVQITKMNGSLKGQNISFAFNNRECSFNTSIIGSFQASNLLIAAL
SIHYIGFDFSKIIEILTQVKSVKGRMERIDNTNIFVDYSHTPDALEKALTELKNIKLRDS
KLIVVFGCGGNRDKTKRGLMGQIAAKLADTVIITDDNPRHEDPKLIRAEIIRCIEKVDYT
EIANREEAIKYGINNLKQDDILLIAGKGHENYQIIGDKKLPFDDAEIVRKLTLLQGKAKH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcctataacctaaaacaattatttcaacaatataaagtaaaaggtttgtcgattaat
tctaaaaccgttaaggagaatgatgtcttttttgcgattaagggacaaaatgtcgatgga
aatgattttataaatgatgctttaaatcaggcggcagcattagtcattacggacaatgaa
aaaagtgctactatagataaaataatctacgtagaagatgtacaagcagctttatatgaa
gctatagaaatcttttatcctaagaaaccaaagcatttgatagccgtaaccggtactaac
ggcaaaagctcggtagtgtcctatatagctcaaacatactcattacttggaaaaaaagcc
gcatctatcggcacgataggtgtagagatttttggctacgataatcttataaatgatatg
ccggaattaaccacacttgattatttaagctttagaaaaattgctcataatttagctgaa
aacaatatagaatatttagcttttgaagcttctagtcatggtattaatcaagcaagactt
ggggaaataaaagtaaatattgcatgttttactagctttagtcaggatcatctagactat
cactatacaaaagaaaattatttattagccaaactgaaattatttactgagcatttatta
caaagcggtcttgcaatattaaattctgatatagaagaaatagagtttattaaagattat
ctgtgtaaccataatattaaatttatcactgttggaaaagaaggtgatgtacaaataact
aaaatgaatggttctttaaaaggacaaaatattagttttgcatttaataatagagaatgt
agttttaatacctctataatcggtagttttcaggctagcaatttgttaattgccgctctt
agcattcattatatcggatttgattttagtaaaataatcgaaattctaacgcaagttaaa
tcggtaaaaggcagaatggaacggatagataacactaatattttcgttgattattcccat
actccggatgctcttgaaaaagctttaacagagctgaaaaatattaaattacgtgatagt
aagctaatcgtagtttttggttgcggcggtaatcgtgataaaacaaagagaggtcttatg
gggcaaatagctgcaaaacttgctgataccgtaataattaccgatgacaacccacgtcat
gaagatccaaaactgatcagagccgaaatcataagatgtatagagaaagtggattatacg
gaaatagcaaatagagaagaggctattaaatatggtataaataatttaaaacaagatgat
attttattaattgccggcaaaggtcatgaaaattaccaaattataggagataagaaatta
ccttttgatgatgctgaaattgtaaggaaactaacgttattgcaaggaaaggcaaagcat
tga

DBGET integrated database retrieval system