KEGG   Rickettsia australis: MC5_04860Help
Entry
MC5_04860         CDS       T01783                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rau  Rickettsia australis
Pathway
rau00020  Citrate cycle (TCA cycle)
rau00640  Propanoate metabolism
rau01100  Metabolic pathways
rau01110  Biosynthesis of secondary metabolites
rau01120  Microbial metabolism in diverse environments
rau01130  Biosynthesis of antibiotics
rau01200  Carbon metabolism
Module
rau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC5_04860 (sucC)
   00640 Propanoate metabolism
    MC5_04860 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MC5_04860 (sucC)
Enzymes [BR:rau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MC5_04860 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFC71263
UniProt: H8K7M0
Position
855123..856283
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQVHAGGRGKAGGV
KVVKSKEEAKKVAHDMLGINLVTHQTAPQGQKVNRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEIAEKTPEKIIKFSVDPAIGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYHAFIETDAAQIEINPLIVQTDGNLLALDAKITFDDNGLFKHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGQEI
LSNSGLEIIPAYDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
actggactcgttgttacgaaaaccgaaaagattaacgaaaccatagataagttaaatacg
gaagtatatgtggttaaagcacaagtacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgcttggtattaat
ttagtaacacatcaaacagcacctcaaggacaaaaagtaaatcgtctttatatcgaatca
ggttgtgatatcttaaaagaatattatttcagtatagtatttgatagatcggcgagttgt
attactttcatagcttctaccgaaggaggagtcgatattgaagaaatagcagaaaaaact
ccggaaaaaattattaaattttctgtggatcctgcaatcggtttacaagattttcatatg
cgtggtatagcttatgagctaggttttaaggataaccaagctaaacagatgaaagaaata
gtaaaatcagtctatcatgcttttattgaaactgatgcggcacaaattgaaatcaacccg
ttaattgtacaaacggacggaaatttactcgctttagatgcaaaaatcacttttgacgat
aacggcttattcaaacatccaaatattacggcaatgcgtgatcacgatgaggaagatcct
ttagaaactagagcggcaaatgcggggcttagctatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgcaggtcttgctatggctactatggatattattaagctttacggt
gcgtcacctgcaaatttcttagatgttggcggcggggctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatccgataaagaagtgcaaggaatcttggttaatattttcggc
ggtattatgcgttgtgatattatagcggaagggattattgcagctgcaaaagacataggg
ataaaagtgccattagtagtccgtttagccggtactaacgttgaaaaaggccaagaaatt
ttatcaaattccggtttagaaataataccggcatatgatttagcagatgcggcaaataag
atagtcgaggctattaggtag

DBGET integrated database retrieval system