KEGG   Rickettsia australis: MC5_05920Help
Entry
MC5_05920         CDS       T01783                                 

Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rau  Rickettsia australis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rau00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MC5_05920
Enzymes [BR:rau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MC5_05920
Transfer RNA biogenesis [BR:rau03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MC5_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046558..1047337)
Genome map
AA seq 259 aa AA seqDB search
MNNNLIAALKDLIINTGKVALDIKKVGILTDIKSDGSVVTNADKEISKIIYQTLRSLTSQ
IAIVCEEQPLPILSSDTFWLIDPIDGTRSYVNGKSTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSKDIFVNHEPKHEELNAVIGFYNSNKATKEFLSKYSFSQINEIG
SSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQEITYGKENFANPN
FFACSKYWLEKRPACHTVV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacttaatagctgctttaaaagatttaattattaataccggcaaggttgca
ctagatataaaaaaggtaggaatattgactgatattaaatcagatgggtcagtagtcact
aatgccgataaggaaattagtaaaataatttatcaaactttacgaagcttaacctctcaa
atagctatagtatgtgaagagcagccgctacctatattaagcagtgatactttttggtta
atcgatcctattgatgggacacggagctatgtaaacggtaaaagtacatatacggtaaat
atagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaaacggca
aagctatattataccgatgtaaacggtcggttaaaaatcgaacagaattctaaagacata
tttgttaatcatgaacctaaacatgaagagcttaatgcggtaataggtttttataattca
aataaagctactaaagaatttttaagtaaatattcattcagtcaaataaatgaaataggc
agttcaattaaattatgcttaattgctgaaggggcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttaattaaagccggcggcggtaat
attttagatacacatggacaagaaattacttacggtaaagaaaatttcgctaatcctaat
tttttcgcctgcagtaaatattggttggaaaaacgtccagcctgtcataccgtggtttga

DBGET integrated database retrieval system