KEGG   Rickettsia australis: MC5_06870Help
Entry
MC5_06870         CDS       T01783                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rau  Rickettsia australis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC5_06870
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC5_06870
  Amino acid metabolism
   00310 Lysine degradation
    MC5_06870
Enzymes [BR:rau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MC5_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213804..1215000
Genome map
AA seq 398 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGDINEGAANTAGTNNESAKAQAVTQPTSEKPVAKPAVVNNILAPSVQ
KLVTDNKLDPNNIKGTGKDGRITKGDILETINTPSAASTTVNKTNEERVQRVRMSRLRKT
IAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIETLK
LIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFADVEKAIGTLAKKAR
EGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPM
MYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcgcttggagagtccgtaacagaagcaactattgcc
aaatggtataagaaagaaggtgattcggttaaaaccgatgaattactgttagaaattgaa
accgaaaaagtgactttagaagttaatgctccttgtaacggcactataggtaaaatatca
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgacataaatgaaggggca
gctaatactgccggtactaataatgaatctgctaaagctcaagcagttacgcaacctact
tcagaaaagcctgtagcaaaacctgccgtggttaataatattcttgctccttccgtacaa
aaattagttaccgacaataagcttgaccccaataatataaaaggcacaggtaaagacggt
agaattaccaaaggcgacatacttgaaacaataaacacaccgtctgctgcttctactaca
gtaaacaaaactaatgaagaaagagtacagcgtgttcgtatgtcacgcttacgtaaaact
attgcacagcgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaa
atcgatatgtcaaaagtaattgccttgcgtaatcaatataaagaagagttcgagaaaaag
cacgctgtgaaacttggctttatgtcgttttttgttaaagcaacaattgaaactttaaag
cttattccatcggtaaatgctgaaatagacggtgatgatttagtatataaaaattactat
gatataggtgtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgcc
gataaaatgggatttgctgatgtagaaaaagctataggcactttggctaaaaaagctcgt
gagggtaaactttctatggctgatttgtcagggggaacattttcgatttctaacggaggc
gtatatggctcattattatctacaccgattattaatcctcctcaatcaggtattttagga
ttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatg
atgtatatagctttatcttacgatcatcgtataattgacgggaaagaaggagtatcgttc
ttggtaaaaattaagcagcttattgagaaccctgaaaagttactactgaatttgtaa

DBGET integrated database retrieval system