KEGG   Rickettsia australis: MC5_07475Help
Entry
MC5_07475         CDS       T01783                                 

Definition
helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rau  Rickettsia australis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MC5_07475
Enzymes [BR:rau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MC5_07475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMC5_1:complement(17688..18146)
Genome map
AA seq 152 aa AA seqDB search
MNKQDVNQHISGIIERITDHNPDNEFCVLRIKVKGHRDSITVTGNVPSALVGEYIKCSGI
WYNDRNHGRQFKAHFIKALPPDTLEGIEKYLGSGLIKSIGPYFAKKLVLAFKDRVLEVIK
HETRLLSTIDGIGKEELTAFAITGRHKKSFVK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaggatgttaatcaacatatatccggcatcatagaacgtattactgatcat
aaccctgataatgaattttgtgtattacgtattaaggtaaaaggtcatagggattcaatt
acagttacaggtaatgtaccatctgcactcgtaggggaatatataaaatgtagtggtatt
tggtataacgatagaaatcatggcagacaatttaaggcacattttatcaaagctttacca
cccgatacgctagaaggtatagaaaaatacctaggttctggattgattaaaagtatagga
ccatattttgctaagaaattagtattagcatttaaagatagagtgcttgaagttattaaa
catgagactcgtcttttatctactatagatgggataggtaaggaagagctaactgcattt
gcaataactggcaggcacaaaaagtcattcgtgaaataa

DBGET integrated database retrieval system