KEGG   Rhodopirellula baltica: RB10114Help
Entry
RB10114           CDS       T00134                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rba  Rhodopirellula baltica
Pathway
rba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01130  Biosynthesis of antibiotics
rba01230  Biosynthesis of amino acids
Module
rba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB10114 (trpC)
Enzymes [BR:rba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RB10114 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-GeneID: 1794165
NCBI-ProteinID: NP_869250
UniProt: Q7UKJ7
Position
5456435..5457214
Genome map
AA seq 259 aa AA seqDB search
MTILDDILVKTRQVIARDQASVPAAELVAAAKDLPVCRDFHGSLAATDQVRLIAEVKRAS
PSAGLIREDFDPPTIAKSYEDGGAACISVLTDEPFFQGSLDYLRQVRSAVDLPILRKDFI
VDPYQLLQARVAGADAVLLIAECLSPQQLIEMDEQASELGLQTLIELYEPENLAPVLATK
TRLVGINNRDLRTFETDLQHCVRLAADIPSDRLVVGESGIRTAADVAMLKAGGIKAILVG
ESLMRQPDITIATKALLAS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctcgacgacatcctggtaaaaacccgccaagtcatcgcgcgtgatcaagct
tccgtgcccgccgcggaactcgtcgcggcggcgaaggatcttcccgtgtgccgagacttt
cacggttcgctcgcggccaccgatcaagttcgcttgatcgccgaagtcaaacgagccagt
ccttccgccggcctgattcgcgaagacttcgacccaccaacgatcgccaagtcgtacgaa
gacgggggagccgcttgcatcagcgtgctcaccgacgaacccttcttccaaggctcattg
gactatctccgccaagtccgctcggcagttgatttgccaatccttcgcaaggacttcatc
gtcgatccctatcaactgctgcaggcccgcgtcgccggtgccgatgcggtgttgttgatc
gccgaatgtctctcgcctcagcaattgatcgagatggatgagcaagcctccgagttgggc
ctgcaaacgctgatcgaactctacgagcctgagaacctggctccggttctggcaaccaag
acccgattggttggaatcaacaaccgagacctgcgaactttcgaaactgatctgcaacac
tgtgttcgcttggcggcggacattccttcggaccgattggtggtcggtgaaagcggcatc
cgaaccgcggccgacgtcgcaatgttgaaagccggcggcatcaaagccatcttggtcggc
gaatcgctgatgcgtcagcccgacatcacgatcgctacgaaggcgttgctcgccagctga

DBGET integrated database retrieval system