KEGG   Rhodopirellula baltica: RB10395Help
Entry
RB10395           CDS       T00134                                 

Gene name
smuG1
Definition
single-strand selective monofunctional uracil DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
rba  Rhodopirellula baltica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rba03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5619254..5620012)
Genome map
AA seq 252 aa AA seqDB search
MTMTSARNPSQEKIQKQLLDAASELSDEVDQLQFAEPVTHVYNPLRYAWNLHQQYVRQIG
ADAHVLFLGMNPGPWGMAQSGVPFGEIDSVVQWMGLKGEVERPSNEHSKRPIEGLNCSRS
EVSGRRLWGLISERYPEPSNFFQQHFVANYCPLVFMEESGRNRTPDKLPAAERDALQAVC
DAHLKKVIAAAPWTDLVGVGAFAENCLQRVVKSMEQTSVSIHRILHPSPASPAANKDWAG
KATSQLVEAQIW
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgacgtcagctagaaatccaagtcaagagaagattcaaaagcaattgctcgac
gccgcgagcgagctttcggatgaagtggatcaactacaattcgctgaaccagtcacccac
gtttacaacccactgcgatatgcgtggaaccttcaccaacaatacgttcggcaaatcggc
gccgatgctcacgtgttgtttctcggaatgaacccggggccatggggcatggcgcaaagc
ggggttccattcggtgaaatcgattccgtggttcagtggatgggtttgaaaggcgaagtc
gaacgtccaagcaacgaacattctaaacgtcccatcgaaggattgaactgttcacgcagc
gaagtcagtgggcgtcggttgtggggattgatttccgaaagataccccgagccgtctaac
ttcttccaacaacacttcgttgcgaattattgtccgctggttttcatggaagaaagtggc
agaaaccgaaccccggacaaactgcccgccgccgaaagagacgctttgcaagcagtctgt
gacgcccacttgaaaaaggtcatcgccgcagccccgtggacggatctggttggcgtgggc
gcgttcgcggaaaattgccttcaacgcgttgtgaagtccatggagcaaacatccgtttcg
atccatcggattttgcatcccagccccgcatccccagcggcgaacaaggattgggcggga
aaagcgaccagccaactcgtggaggctcaaatttggtga

DBGET integrated database retrieval system