KEGG   Rhodopirellula baltica: RB10395Help
Entry
RB10395           CDS       T00134                                 

Gene name
smuG1
Definition
single-strand selective monofunctional uracil DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
rba  Rhodopirellula baltica
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rba00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RB10395 (smuG1)
Enzymes [BR:rba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     RB10395 (smuG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5619254..5620012)
Genome map
AA seq 252 aa AA seqDB search
MTMTSARNPSQEKIQKQLLDAASELSDEVDQLQFAEPVTHVYNPLRYAWNLHQQYVRQIG
ADAHVLFLGMNPGPWGMAQSGVPFGEIDSVVQWMGLKGEVERPSNEHSKRPIEGLNCSRS
EVSGRRLWGLISERYPEPSNFFQQHFVANYCPLVFMEESGRNRTPDKLPAAERDALQAVC
DAHLKKVIAAAPWTDLVGVGAFAENCLQRVVKSMEQTSVSIHRILHPSPASPAANKDWAG
KATSQLVEAQIW
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgacgtcagctagaaatccaagtcaagagaagattcaaaagcaattgctcgac
gccgcgagcgagctttcggatgaagtggatcaactacaattcgctgaaccagtcacccac
gtttacaacccactgcgatatgcgtggaaccttcaccaacaatacgttcggcaaatcggc
gccgatgctcacgtgttgtttctcggaatgaacccggggccatggggcatggcgcaaagc
ggggttccattcggtgaaatcgattccgtggttcagtggatgggtttgaaaggcgaagtc
gaacgtccaagcaacgaacattctaaacgtcccatcgaaggattgaactgttcacgcagc
gaagtcagtgggcgtcggttgtggggattgatttccgaaagataccccgagccgtctaac
ttcttccaacaacacttcgttgcgaattattgtccgctggttttcatggaagaaagtggc
agaaaccgaaccccggacaaactgcccgccgccgaaagagacgctttgcaagcagtctgt
gacgcccacttgaaaaaggtcatcgccgcagccccgtggacggatctggttggcgtgggc
gcgttcgcggaaaattgccttcaacgcgttgtgaagtccatggagcaaacatccgtttcg
atccatcggattttgcatcccagccccgcatccccagcggcgaacaaggattgggcggga
aaagcgaccagccaactcgtggaggctcaaatttggtga

DBGET integrated database retrieval system