KEGG   Rhodopirellula baltica: RB10537Help
Entry
RB10537           CDS       T00134                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rba  Rhodopirellula baltica
Pathway
rba00900  Terpenoid backbone biosynthesis
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RB10537 (ispE)
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RB10537 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 1794233
NCBI-ProteinID: NP_869474
UniProt: Q7UEV3
Position
complement(5715502..5716491)
Genome map
AA seq 329 aa AA seqDB search
MTESRWYSTSPPAKLNLFLELLARRDDGFHELDTVMVAIDWRDELHVRRTTNPGVQLSVD
WTDGRTSVAAELQVDEDNELLLVPTDDKNLVVRALNRLTETLRLDGGWEVQLNKNIPSGA
GMGGASSDAASALQLGWAAARETQSDLPETLKNETLLSLAAEIGSDVPFFLGDLQADRLV
QCAHATGRGEKLNFFTLANPLHAVVIYPAASVSTAQVYSRCQVPDSPQSSNELLRALQGI
AAESEFSLHNALQAPARGLSSRIDPALECLSKAGLTHCHMTGSGSACFALADSSQQAAIA
AETLRSTFPGGALIRPVMSCVVPSEIHIA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatctcgctggtattccacgtcgcctcccgccaaactcaatctcttcctcgaa
ctcttggcacgtcgcgacgacggttttcatgaactggataccgtgatggtcgcgatcgat
tggcgagatgaacttcatgtccgtcgcaccacgaatcccggtgtccaactttcggttgat
tggacggatggacgaacttcggtcgctgcagaattgcaagtcgacgaagacaacgaattg
ctactggtcccgaccgatgacaaaaacctggtcgtgcgtgctctcaatcgtctcactgaa
acgctgaggttagacggcggctgggaagttcaactgaacaaaaacattccaagcggggcg
ggaatgggtggcgccagcagcgatgctgcgtcggcgttgcaattgggatgggccgccgct
cgtgagacgcaatcggacctgcccgaaacgcttaagaatgagacgcttctttctttagca
gcggaaattggaagtgacgtcccatttttcttaggtgatctgcaagccgaccgtttggtt
caatgcgcacatgcaaccggacgtggtgagaaattgaacttcttcacattagccaatcca
ctgcacgcagtcgtcatttacccagcggcgagtgtttcgaccgcacaagtctattcaagg
tgccaagtccccgattctccccaatctagcaacgaattattgcgtgctttgcaaggaatc
gcagcggaatccgagttttcattgcataacgccttgcaagcgcccgcacgcgggctttca
tcgcgcatcgatcccgccctagaatgtctgtcgaaggctggactgacacattgccacatg
acgggcagcggttcggcttgcttcgctttggcagactcgtcgcaacaagcagcaatcgct
gctgaaactttgcgttcgacttttccgggcggcgcattgatccgaccggttatgagttgt
gtggtgccgtcggagatccacatcgcatag

DBGET integrated database retrieval system