KEGG   Rhodopirellula baltica: RB10650Help
Entry
RB10650           CDS       T00134                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rba  Rhodopirellula baltica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB10650 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB10650 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB10650 (trpB)
Enzymes [BR:rba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RB10650 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5779234..5780457
Genome map
AA seq 407 aa AA seqDB search
MSTAPSQQHASAQVPDPRGRFGDFGGRFVPETLTRALDELSEEYEKAKRDPEFQRELDGL
LKTFVGRPSPLYHAKRLSSAVGGAQIWLKREDLNHTGAHKINNTIGQALLTLRMGKTRVI
AETGAGQHGVASATACAHFGLPCTVYMGAEDIRRQKPNVFSMKLLGANISAVESGSRTLR
DAVNEAMRDWMSSVEDTHYIIGSVIGPHPFPMMVRDFQSVIGRETREQCRDTFGRLPDCV
VACVGGGSNAAGMFYPFVEDEGVRMVGVEAGGRSATPGDHASPLSYGNPGVLHGSYSYVM
QDEDGQTCDVHSMSAGLDYPGVGPEHSYWKDTKRVDYIDCRDDEALTAFERLASSEGILA
ALETSHAVAKAIEIAGKMSDQEHLVICLSGRGDKDSMEIARLRGEEW
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccccgtcgcagcaacacgcctccgcccaagttcccgatccccgcgggcga
tttggcgattttggtggccgtttcgttcccgagacactcacgcgggcactcgatgagctt
tccgaagagtacgagaaggccaagcgggacccggaattccagcgtgaattggatggattg
ctgaagaccttcgtcggtcgccccagcccgctgtatcacgccaaacggttgtcgtcggcg
gttggtggagcccaaatttggttgaaacgcgaagacctcaaccacaccggtgctcacaaa
atcaacaacacgatcgggcaagcgttgctgacgttgcgaatggggaaaacccgagtgatc
gccgaaacgggtgccggacaacacggcgtggcgtcggcgaccgcttgtgcgcactttggt
ctgccctgcaccgtttacatgggtgcggaagacatccggcggcagaaacccaatgtgttc
agcatgaagttgctcggtgccaatatctcggccgtcgagtccggttcgcggacgctgcgt
gatgccgtcaacgaagcgatgcgagactggatgtcttcggttgaggacacccactacatc
atcggcagcgtgatcggtccgcacccattcccgatgatggttcgcgatttccaatcggtg
atcggtcgcgaaacccgcgagcagtgccgagacacatttgggcgtttgcctgattgcgtc
gtcgcatgcgtcggcggtggcagcaacgcggccggcatgttctatccgtttgtggaagac
gaaggtgttcgaatggtcggtgtcgaagccggcggtcgatcagcaacgcccggcgatcac
gcgtcgccattgtcttatggaaaccccggtgtcttgcacggcagttacagctatgtgatg
caagacgaggatgggcaaacgtgcgacgtccattcgatgagcgcagggttggactatccc
ggtgttggtccagaacacagttattggaaagacaccaaacgcgttgactacatcgattgt
cgtgacgacgaggcgttgaccgcgtttgaacgattggcatccagcgaaggtattctcgcg
gcacttgaaacctcacatgcggtggccaaagccatcgagatcgcgggcaagatgtcggac
caagaacacttggtgatttgcttgtccggccgaggcgacaaggactcgatggaaatcgct
cgtcttcgcggcgaagagtggtga

DBGET integrated database retrieval system