KEGG   Rhodopirellula baltica: RB10805Help
Entry
RB10805           CDS       T00134                                 

Definition
iron alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RB10805
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB10805
  Lipid metabolism
   00071 Fatty acid degradation
    RB10805
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB10805
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB10805
   00626 Naphthalene degradation
    RB10805
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB10805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5869621..5870781
Genome map
AA seq 386 aa AA seqDB search
MQPFDLHQRTRIVFGPNVSNQINELARSLGGVLDSGRPRVLVVCDPGIVAAGHFDRITGL
LRDKNWEVHAFHEFAENPTSAMVDAGVSVAADFQPDLLIGLGGGSSMDCAKGINFVYSCG
GRIHDYHGVGKATSEMLPMIAIPTTAGTGSEAQSFALISDAETHVKMACGDPKAACRIAL
LDPTFTLTQPRGVTALTGIDAISHAVETYVSKKRNVMSTTYSRRAFGLLGRSFVRVLQVP
DDLEARADMQLGACLAGMAIETSMLGAAHATANPLTARHNVVHGQAVGLMLPAVVRFNGT
VHADWYSELLRELEPHSEISEAPTRLAELIEEWMREADLATTLDDLSIPTSDIGLFVEDA
LKQWTGTFNPIELDEDSTRALYREVV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgtttgatcttcatcaacgaacgcgaatcgtgtttgggccgaacgtttcgaat
cagatcaacgagttggcacgctctctcggtggcgtcttggactcgggacgacctcgagtt
ttggtcgtctgcgatccaggaattgtcgcggctggccattttgatcgcatcaccgggttg
ctgcgtgacaaaaactgggaagtccacgcgttccatgaattcgccgaaaacccaacttcg
gcgatggtggacgcgggggtgagtgttgcagcggactttcagccggatctgctgattggg
cttggcggcggcagcagcatggactgcgccaaagggatcaactttgtgtacagctgcggt
ggtcgcattcatgactaccatggcgtgggcaaggcgacgtcggagatgctgccgatgatt
gccattccgacgactgcggggaccggcagcgaagctcaaagttttgctttgatcagcgac
gctgagacacacgtgaagatggcgtgcggtgatcccaaggcagcatgccgaatcgctttg
ctggatccgacgttcacgttgacccagccacgcggagtgacggcgctgaccggcatcgat
gcgatctcgcatgcggttgaaacctacgtcagcaagaaacgcaacgtgatgtcgacgacc
tacagtcgacgggcattcggattgttgggccgatcattcgtccgagtgttgcaggtgccc
gatgacttggaagctcgcgcagacatgcaacttggcgcgtgtctggctggcatggcgatc
gaaacatcgatgttgggcgcggcgcacgccacggccaatcctttgactgcccggcataac
gtggttcacggacaggcggtcggattgatgttgccagcggtggttcgtttcaacggaact
gttcacgcggattggtattcggagttgttgcgtgagttggaaccgcacagtgagatttcc
gaggcgccaacacgtttggccgaattgattgaagagtggatgcgagaagcggatctcgcg
acgacgctggatgatctatcgatcccaacatcggacattggattgttcgtcgaagatgcg
ctgaagcagtggacgggaacgttcaatcccatcgagctcgacgaagactccacgagagcg
ctgtatcgcgaagtggtttag

DBGET integrated database retrieval system