KEGG   Rhodopirellula baltica: RB10894Help
Entry
RB10894           CDS       T00134                                 

Gene name
thrC
Definition
threonine synthase (EC:2.5.1.47 4.2.3.1 4.3.1.19)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB10894 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB10894 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RB10894 (thrC)
Enzymes [BR:rba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RB10894 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5915024..5916394)
Genome map
AA seq 456 aa AA seqDB search
MSLAVESKPDVDHQTTYFRCISGCSARHSIFDVIYTCPTCGSLLEVYHEREPLKKKNAYQ
WQQLFDSRASTSKWPFGSGVWGMREWVVPSLADENVVSMFEGNTNLFWAERLGAQLGVPD
LWIKLCGNSHTGSFKDLGMTVLVSVVKQMMAQGSSVKAVACASTGDTSAALAAYAAYAGI
PAVIFLPAGKVSTAQLIQPVANGAHVLALDTDFDGCMKIVQEVTKDNSIYLANSMNSLRI
EGQKTVGIEMVRQFEWEVPDWIIIPVGNLGNISALYKGFKLMMDLGLINRMPRLVAAQTE
RANPFYTAYKNGFAEKVSVTAQDTLANAIRIGDPVSYAKAVKAVQETNGIVEQASENELA
EASASADLTGMFTCPHTGVALAVLKKLIDRGEISPKDKTVVISTAHGLKFTDFKVGYHES
TLEGIDSKHANPAVHLPADANAVKDEIARRLEQHNG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgccgtcgagtccaaaccggacgtggaccaccaaaccacctatttccgctgc
atttcaggctgcagcgcgaggcactcgatctttgatgtgatctacacctgcccaacctgc
ggcagtctgttggaggtctatcacgagcgagaaccgctgaaaaagaagaacgcctatcag
tggcaacagctttttgattcgcgtgccagcacctcgaaatggccgtttggcagtggcgtt
tggggcatgcgagagtgggtcgttccatcgctggcagacgaaaatgtcgtcagcatgttc
gagggaaacacgaacctcttctgggccgagcgacttggcgcccaactcggtgttcccgat
ctgtggatcaaactttgcggcaacagccacacgggcagcttcaaagacttgggcatgacc
gttttggtcagcgtcgtcaaacaaatgatggctcaaggcagcagcgtgaaagctgtcgcc
tgtgccagcaccggtgacaccagtgcggctctggccgcctatgccgcatacgccggtatc
cccgcagtgatctttttgcccgctggaaaggtcagcacggcccagttgatccagccggtc
gcaaatggcgcacacgtgctggctctcgataccgacttcgacggatgcatgaaaatcgtc
caagaagtgaccaaggacaattcaatctacctcgccaactcgatgaacagccttcgcatc
gaaggtcaaaaaacggttggcatcgaaatggttcgccaattcgaatgggaagttccggat
tggatcatcatcccggttggcaatctcggaaacatcagcgctctctacaagggattcaag
ctgatgatggatttgggactgatcaaccgcatgcctcgattggtcgccgcccaaaccgaa
cgagccaacccgttttacaccgcatacaagaacggctttgcagaaaaggtcagtgtcacc
gctcaagacacactggccaatgcaatccgcatcggtgatccggtcagctatgccaaagca
gtcaaagctgtccaagaaaccaacggcatcgttgaacaggcctccgaaaacgagttggcg
gaagcgtccgcgtccgctgacctgaccggcatgttcacatgcccacataccggcgtcgca
ctggctgtgctgaagaaactgattgaccgaggtgagatctcaccaaaggacaagaccgtt
gtcatcagcaccgctcacggattgaagttcacggatttcaaagtcggctaccacgagtca
acgctcgaaggcatcgacagcaaacacgccaacccggcggttcacttgcccgccgatgca
aacgctgtcaaagacgagatcgcccgccgcctggaacagcacaacggctga

DBGET integrated database retrieval system