KEGG   Rhodopirellula baltica: RB1092Help
Entry
RB1092            CDS       T00134                                 

Gene name
faoA
Definition
fatty oxidation complex alpha subunit (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
rba  Rhodopirellula baltica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB1092 (faoA)
   01212 Fatty acid metabolism
    RB1092 (faoA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RB1092 (faoA)
   00650 Butanoate metabolism
    RB1092 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    RB1092 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    RB1092 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RB1092 (faoA)
   00310 Lysine degradation
    RB1092 (faoA)
   00380 Tryptophan metabolism
    RB1092 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RB1092 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RB1092 (faoA)
   00281 Geraniol degradation
    RB1092 (faoA)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RB1092 (faoA)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RB1092 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RB1092 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RB1092 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     RB1092 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565978..567168
Genome map
AA seq 396 aa AA seqDB search
MTESIRVLLVGAGVVGRAIATDHLLAGCEIWMADRDEAVLSEACDAVLRRTDGIADSASP
WGAAVPIPVVHMMPHGHDETIGASDALPTWVVIESIAEKLPIKQAFFAEVENWFARSPIL
TTNTSTLPITEIAGAMRTHSARFCGMHFFMPVVGRHAAEIIVHSRTSEAVIEACEGHVRR
LKKAPLRVLDSPGFVVNRMLAPYLNLSMQLLCAGVAASTIRESALRYGMPMSPFELIDLI
GPRTAFDGGRVVWQSFPHRMDPSPLLPAMIKRSLLGVAGQKGFYEYSGDGERSGDDLSDD
VNALVERYSRDDIGAADIRGDVQLIADMFAASMWREAQAIVAFHVADMETINQAMAGGLG
YVAPTIETSWREHIESIGEDRFEQIADRFPKLKSLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaatcgattcgagttttgctggtcggcgccggtgtggtcggtcgcgccatcgcg
acggatcatttgctggccggatgcgaaatctggatggcggaccgtgacgaggcggtgctg
tccgaggcatgcgacgcggtgctccggcgaacggatgggatcgctgattcggcttctcca
tggggagcggcggtgccaattccagtcgttcatatgatgccgcatggccacgacgaaacg
atcggggcatcggatgctttgccgacttgggtggtgatcgagtcgatcgcggagaagttg
cccatcaagcaagctttctttgccgaagtcgaaaactggtttgcacgttcgcccattttg
accaccaatacatcgacgttgcccatcaccgagatcgctggtgcgatgcgaacacattcg
gcgcggttttgcgggatgcatttcttcatgcccgtcgtcgggcgtcatgccgcggaaatc
atcgttcattcgagaaccagcgaagcagtcatcgaggcatgtgaagggcatgtccggcgt
ttgaagaaagccccgctgcgggtgctggattcacctggcttcgtcgtcaatcgcatgttg
gcgccgtatttgaacctttcgatgcagctgctgtgtgctggcgttgcggcatcaaccatt
cgcgaatcggcgctgcggtatggcatgccgatgtcaccgtttgagttgatcgacttgatc
ggaccgcggaccgcctttgacggggggcgagtggtttggcaatcgtttccccatcgaatg
gatccatcaccattgttgcccgcgatgatcaaacgttctctgctcggtgtcgctggtcaa
aaaggtttctatgaatactcgggcgacggcgaacgtagcggagatgatctatccgatgac
gtaaacgccttggtcgagcgatattcgcgtgacgacattggtgcggccgacatccgaggc
gatgttcagttgatcgcggatatgtttgccgcgtcgatgtggcgtgaggctcaggcaatc
gtcgcatttcatgttgctgatatggaaacgatcaatcaagcgatggcgggcggattgggg
tatgtcgcaccgaccattgagacgtcttggcgagagcacatcgaatcgattggtgaggac
cgcttcgagcagattgccgatcgcttcccgaaactcaaatcgctccgttag

DBGET integrated database retrieval system