KEGG   Rhodopirellula baltica: RB12133Help
Entry
RB12133           CDS       T00134                                 

Gene name
dapE
Definition
ArgE/DapE/Acy1 family protein (EC:3.5.1.16 3.5.1.18)
Orthology
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rba  Rhodopirellula baltica
Pathway
Lysine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RB12133 (dapE)
   01230 Biosynthesis of amino acids
    RB12133 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    RB12133 (dapE)
   00330 Arginine and proline metabolism
    RB12133 (dapE)
Enzymes [BR:rba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     RB12133 (dapE)
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RB12133 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6548699..6550105)
Genome map
AA seq 468 aa AA seqDB search
MSQPEQSSSSASQLPAEVQSRLDDGKQRHEAELIEWLKIPSISSDSTRRDDVHQAATWLL
EKMNAAGLQTESISTNGFPLLVASTPPVPGAPVALVYGHYDVQPPEPLDLWTSPPFEPVV
RDGKVFARGATDDKGQVLTHIHSVCDWLASGQPLPLQIKFLIEGEEEVGSQNLDDWLPEL
AEKLACDVVVVSDSSQYAPGRPAVTCGLRGIATYELFVDGPSHDLHSGSFGGAVANPAMA
LCQLLASMKDANGKIAIEGLYDDVAPITDIEREAWKKLGADDAEFASSVGASELHGEAGY
TTDERRWARPSLDINGLTSGHQGEGVKTVLPAKASAKFSFRLVPNQDPKRLTGLIESHLE
RHCPPGIRWTLKPDHGAGAMLADANSRYAKAASVAIEKAFGTPPVMIREGGSIPILARFQ
EVLDCDCLLLGWGQNDDAAHSPNEKFSLEDFHRGIQASASLWQAIASA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacccgaacaatcttcctcatccgcgtctcagttgcccgccgaagttcagtcg
cgattggacgacggcaaacagcgtcacgaagccgaattgattgagtggttgaaaatccca
agcatcagcagcgattcgacccgccgcgacgacgttcaccaggccgccacttggttgctt
gaaaagatgaacgcggccggcctgcaaaccgaatccatctccaccaacggattcccgctg
ctggttgcctccaccccgccagtccccggtgcccccgtggccctggtttacgggcactat
gacgtccagccacctgagccgctggatctttggaccagcccaccgttcgaacccgttgtc
cgcgacggcaaggtctttgcccgcggtgcaacggacgacaaaggccaagtcctgacgcac
attcacagcgtttgcgattggctcgccagcggacaacccttgccgctgcaaatcaaattt
ttgatcgagggcgaagaggaagtcggcagccaaaacctggacgattggttgcccgagctc
gctgaaaagttggcctgcgacgtggtcgtggtcagcgacagcagccagtacgcaccgggt
cggcccgccgtgacgtgcggcctgcgaggcattgcaacgtacgaattgttcgtcgacgga
ccgagccacgacctgcacagcggcagcttcggtggtgcggtcgccaaccccgccatggct
ctgtgtcagttgctagccagcatgaaagacgcgaacgggaaaatcgcaatcgagggcctg
tatgacgatgtcgccccgattaccgacattgaacgcgaggcttggaagaaactcggtgcc
gacgacgccgaattcgcgagcagcgtcggtgcgtccgaactgcacggcgaagcgggttac
acaaccgatgaacgacgctgggcgcgtccctcgctcgacatcaacggtttgacctccgga
catcaaggcgaaggcgtcaaaacggttttgcctgccaaagcgtccgcgaagttcagcttc
cgattggtgcccaaccaagacccgaaacgtctgaccgggttgatcgaatctcacctcgag
cgtcattgcccgccgggtatccgctggacgctaaaacccgatcacggtgccggtgcgatg
ttggcggatgccaacagccgctacgccaaggcagccagcgtcgcgatcgagaaagcgttc
ggaacaccacccgtgatgattcgcgaaggcggctcgatcccaatcctggctcggttccaa
gaagtcctggattgcgattgcttgcttctcggttggggccaaaacgacgatgccgctcac
agccccaacgaaaagttctcactcgaagatttccaccgaggcatccaagcctccgcctcg
ctctggcaagccatcgcatccgcgtga

DBGET integrated database retrieval system