KEGG   Rhodopirellula baltica: RB1220Help
Entry
RB1220            CDS       T00134                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rba  Rhodopirellula baltica
Pathway
rba00010  Glycolysis / Gluconeogenesis
rba00052  Galactose metabolism
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01120  Microbial metabolism in diverse environments
rba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB1220 (galM)
   00052 Galactose metabolism
    RB1220 (galM)
Enzymes [BR:rba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RB1220 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim OMP_b-brl
Motif
Other DBs
NCBI-GeneID: 1790949
NCBI-ProteinID: NP_864293
UniProt: Q7UXN4
Position
622840..623925
Genome map
AA seq 361 aa AA seqDB search
MQRFMSLVTTPFGQTKDGKPVQKITLTNSHGHRVSVMNWGASLLEVEVPDRDGKLANVNM
VFDSIDRYLDSHPGFGSSIGRFCNRIGLAKFEIDGETYQVTVNHGKHCLHGGKVNFSHKW
WDADLISGKDANGNPEIGVRYSLVSPDGDEGFPGEVTVTAEYRWNDASELTIEFTATTTK
PTHVNLTNHSYWNLAGIAPGDGGASSIHDHVALLHCNETLDVDEDLIPTGTTSSVEGTPF
DFLHPETFGKRIDQLPATKGYDHCYVVAGEPGKLRPAARVVDPKSGRTFEIETTQPGMQL
YTANHLGGNASSAGHRSHEAFCLETQHYPDACNHPNFKSTLLRPGDKLKETTVHRFGVEA
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcgatttatgagcctcgtcacgactccattcggccaaaccaaggacgggaaaccg
gtccagaaaatcacgctgaccaattcgcacggccatcgtgtatcggtcatgaactgggga
gcatcgctgctggaagtcgaggtccctgatcgcgacggcaaactggcgaacgtgaatatg
gtgttcgactcgattgatcgctacctggattcgcacccgggtttcgggagctcgatcggt
cggttctgcaaccgcatcggtttggcgaaattcgagatcgatggggagacctatcaggtc
accgtcaatcatggcaagcattgcttgcacggcggcaaagtcaatttctcacacaagtgg
tgggacgccgatttgatctccggcaaagatgccaacggcaatccggagattggtgttcgg
tacagcttggtcagcccggacggagacgaaggtttcccgggtgaagtgactgtgacggcg
gagtaccgctggaacgatgccagcgaattgacgatcgagttcactgcgacgacgaccaag
ccgacccatgtgaacttgaccaaccacagctattggaacttggccggcatcgcacctggt
gacggcggagcaagctccatccatgatcacgtcgcgctgcttcactgcaacgaaaccttg
gacgtcgacgaggacttgattccaactggaacgacctcgtcggtcgagggaacgcctttc
gatttcttgcatcctgaaaccttcggcaaacgcatcgatcaactgcccgccaccaagggc
tacgaccactgctacgtcgtcgcgggagaacctggcaagctgcgaccagcggcccgcgtg
gtggatccgaaatcgggccgaacgttcgagattgaaacgactcaaccaggcatgcagctt
tacaccgccaatcacctgggcggcaacgcgtcgtcagccggacacagatcgcacgaagcg
ttctgcttggaaacgcagcattaccccgatgcatgcaatcacccgaatttcaaaagcacg
ctgttgcgtcccggtgacaaactgaaggaaacgaccgtgcaccgatttggggtggaagct
ggttga

DBGET integrated database retrieval system