KEGG   Rhodopirellula baltica: RB12551Help
Entry
RB12551           CDS       T00134                                 

Gene name
scd
Definition
fatty-acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rba  Rhodopirellula baltica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RB12551 (scd)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RB12551 (scd)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RB12551 (scd)
Lipid biosynthesis proteins [BR:rba01004]
 Desaturase
  First
   RB12551 (scd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6762717..6763907
Genome map
AA seq 396 aa AA seqDB search
MCHPREAFVYRDAFGGLRESFFLSTFDTICCGMIGETAGADRVNSLCRELIPGFMMTTEA
ATIPVRPSQANLEADVLSPIQPDTPTSSYPDAGASSYSDPTKRSIRWDYTIFFVSLHLLT
LLVLLPYFFSWAGVAAFVVGVIVFGQMAIPIGYHRMLSHRSFRSPKWFERTLVTLAMCTA
QETPAHWVAWHRMHHSHSDHAEDPHSPRISFMWAHVRWLVHESRTRMATFSMYEKYARDI
LSDPYYRWIEKLPSPAGMFYLAHAFVYALLAVGISGLVYGNNADAYQMAASVFVWGVIAR
TVWVWHITWSVNSITHVFGYRNYQTTDDSRNNWFVSLLTAGEGWHNNHHADPASASVQHR
WWEIDPNYYVIRLFGVLGLATHIIRPRHVRKSGAES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtcatcctcgcgaagcgttcgtttatagagacgcgttcgggggactgcgtgaatcg
ttcttcctttctaccttcgatacgatatgctgcggcatgatcggagagacggcgggtgcc
gatcgagtgaattcactttgccgcgaactcatcccaggtttcatgatgaccaccgaggcg
gcaacgatcccagttcggcctagccaagccaacttagaggctgatgtcctatcgccaatc
cagcctgacacgcccacgtcaagctatcctgatgcaggggcgagttcctacagcgatcca
accaagcgttcgatccgttgggactacacgatcttttttgtgtcgctgcacttgttgacg
ctgttggtgttgcttccctatttcttttcttgggctggcgttgctgcgtttgtggttggt
gtcattgtctttgggcaaatggcgattccaatcggttaccaccgcatgttgtcgcaccgc
agttttcgatcacccaagtggttcgagcggaccctggtgacgttggccatgtgcaccgcc
caggagacgcccgcacactgggtggcttggcatcggatgcaccatagtcattccgaccat
gctgaggatccgcattcgccacgcatcagcttcatgtgggctcacgtgcgatggttggtg
catgagagtcggacgcggatggcgactttttcgatgtacgaaaagtacgcccgagacatt
ctgtcggacccttattaccgatggatcgaaaaactacccagcccagcgggaatgttctat
ctcgcacacgcgtttgtgtatgcgttgttggccgtcgggatttcggggcttgtttacggc
aacaacgccgatgcctatcagatggcagcgagtgtcttcgtttggggagtgattgcacga
actgtttgggtttggcacatcacttggtcggtcaattcgatcacccacgtgtttggatac
cgaaactatcaaacgaccgacgacagtcgcaacaactggtttgtcagcttgctgaccgcc
ggcgaaggttggcacaacaaccatcacgcggatccggccagcgcttcggtccagcaccgc
tggtgggagatcgatcccaattattacgtgatccgattgttcggagtcttgggtttggct
acccacatcatccgccctcgccacgtgcgaaagagcggagcggaaagctaa

DBGET integrated database retrieval system