KEGG   Rhodopirellula baltica: RB12551Help
Entry
RB12551           CDS       T00134                                 

Gene name
scd
Definition
fatty-acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rba  Rhodopirellula baltica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rba01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rba01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6762717..6763907
Genome map
AA seq 396 aa AA seqDB search
MCHPREAFVYRDAFGGLRESFFLSTFDTICCGMIGETAGADRVNSLCRELIPGFMMTTEA
ATIPVRPSQANLEADVLSPIQPDTPTSSYPDAGASSYSDPTKRSIRWDYTIFFVSLHLLT
LLVLLPYFFSWAGVAAFVVGVIVFGQMAIPIGYHRMLSHRSFRSPKWFERTLVTLAMCTA
QETPAHWVAWHRMHHSHSDHAEDPHSPRISFMWAHVRWLVHESRTRMATFSMYEKYARDI
LSDPYYRWIEKLPSPAGMFYLAHAFVYALLAVGISGLVYGNNADAYQMAASVFVWGVIAR
TVWVWHITWSVNSITHVFGYRNYQTTDDSRNNWFVSLLTAGEGWHNNHHADPASASVQHR
WWEIDPNYYVIRLFGVLGLATHIIRPRHVRKSGAES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtcatcctcgcgaagcgttcgtttatagagacgcgttcgggggactgcgtgaatcg
ttcttcctttctaccttcgatacgatatgctgcggcatgatcggagagacggcgggtgcc
gatcgagtgaattcactttgccgcgaactcatcccaggtttcatgatgaccaccgaggcg
gcaacgatcccagttcggcctagccaagccaacttagaggctgatgtcctatcgccaatc
cagcctgacacgcccacgtcaagctatcctgatgcaggggcgagttcctacagcgatcca
accaagcgttcgatccgttgggactacacgatcttttttgtgtcgctgcacttgttgacg
ctgttggtgttgcttccctatttcttttcttgggctggcgttgctgcgtttgtggttggt
gtcattgtctttgggcaaatggcgattccaatcggttaccaccgcatgttgtcgcaccgc
agttttcgatcacccaagtggttcgagcggaccctggtgacgttggccatgtgcaccgcc
caggagacgcccgcacactgggtggcttggcatcggatgcaccatagtcattccgaccat
gctgaggatccgcattcgccacgcatcagcttcatgtgggctcacgtgcgatggttggtg
catgagagtcggacgcggatggcgactttttcgatgtacgaaaagtacgcccgagacatt
ctgtcggacccttattaccgatggatcgaaaaactacccagcccagcgggaatgttctat
ctcgcacacgcgtttgtgtatgcgttgttggccgtcgggatttcggggcttgtttacggc
aacaacgccgatgcctatcagatggcagcgagtgtcttcgtttggggagtgattgcacga
actgtttgggtttggcacatcacttggtcggtcaattcgatcacccacgtgtttggatac
cgaaactatcaaacgaccgacgacagtcgcaacaactggtttgtcagcttgctgaccgcc
ggcgaaggttggcacaacaaccatcacgcggatccggccagcgcttcggtccagcaccgc
tggtgggagatcgatcccaattattacgtgatccgattgttcggagtcttgggtttggct
acccacatcatccgccctcgccacgtgcgaaagagcggagcggaaagctaa

DBGET integrated database retrieval system