KEGG   Rhodopirellula baltica: RB13184Help
Entry
RB13184           CDS       T00134                                 

Gene name
dsbD
Definition
(RefSeq) thiol:disulfide interchange protein
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
rba  Rhodopirellula baltica
Brite
Enzymes [BR:rba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RB13184 (dsbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_7 Thioredox_DsbH Thioredoxin_2 Thioredoxin Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 1796777
NCBI-ProteinID: NP_870910
UniProt: Q7UHI2
Position
complement(7078691..7079314)
Genome map
AA seq 207 aa AA seqDB search
MKIGVGQRGEMAGVRLRTYPTVNREPHMKDQDSELPSDETMDPSPTRKPRFHFWRCFWLT
FLVVSLGYAWHCFYVPANEIAWAKDYASAKRQAAKADKPILLSFTANWCVPCRVMKRQVW
ADPQVMQLVNAEFVPVAIDVGDPKNAEVMDAYNIQGPPVTIVCNSQGQALDWRAGGISQP
VILELLDSSHSLSGGFEATQHVADSGP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcggtgtcgggcagcgtggcgaaatggcgggtgtcaggttgaggacttacccg
accgtcaatcgagaaccacacatgaaagatcaagactccgagcttccatccgatgagacg
atggatccaagccccacgcgaaaaccccggtttcatttctggcgctgcttctggctgacg
tttcttgttgtttcactcggctatgcttggcattgcttctacgttcccgcgaacgagatc
gcttgggcgaaagactacgcttcggcgaagcggcaagcagctaaggccgacaaaccgatc
cttctctctttcactgccaactggtgcgttccctgccgcgtcatgaagcgtcaagtttgg
gctgatccccaggtgatgcaattggtcaatgcggagttcgttccagtagcgatcgacgtg
ggcgatcccaaaaacgcagaagtcatggacgcctacaacattcaaggtccgccggtcacc
atcgtttgcaactcacaagggcaggcgttggattggcgagcaggaggcatcagccaaccg
gtcatcctcgaattgcttgattcgtcgcattcgctgagcggtggtttcgaagccactcaa
catgtagccgactcaggcccttga

DBGET integrated database retrieval system