KEGG   Rhodopirellula baltica: RB1321Help
Entry
RB1321            CDS       T00134                                 

Definition
transcription repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB1321
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB1321
   00052 Galactose metabolism
    RB1321
   00500 Starch and sucrose metabolism
    RB1321
   00520 Amino sugar and nucleotide sugar metabolism
    RB1321
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RB1321
   00524 Butirosin and neomycin biosynthesis
    RB1321
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RB1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670478..671455
Genome map
AA seq 325 aa AA seqDB search
MKDIWIGFDLGGTKMLAVAYDHEFKELGRRRRKTRGREGSDSGIARIGSTIQRLLDENEL
DVDRIAGIGIGCPGPIDLKKGRILMTPNLGWDDVDIQSFLEKKFDCPATVLNDVDAGVYG
EFLFGAAKGSRCAVGVFPGTGIGGGCVYEGQILHGDGISCMEIGHTRISSGTRASGSSMS
GTLEAEASRLTIASEAAKAAYRGEAPALLEDAGTDLAEIRSGALADSIKNGDKAIKALVE
SASVTVGYGVANIVNLLCPDTIILGGGLVEAMEDLIVGTVRKTARENVMPVYKDRFEVKP
AKLGDDAGVLGAAAWAKKTYPQPPE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacatctggatcggttttgatctcggcggcaccaaaatgctcgctgtcgcttac
gatcatgaattcaaagaactcggtcgtcgccgtcgcaagactcgcggacgcgaaggctct
gacagtgggattgctcggatcggatcgacgatccagcgtttgcttgatgaaaacgagctg
gatgtcgaccgcatcgctggcatcggaattggatgtccggggccgatcgatttgaagaag
gggcggatcttgatgactccgaacctgggttgggacgatgtggatattcaatcgttcttg
gaaaagaagttcgattgtccagccaccgttctgaacgatgttgatgcgggcgtgtacggc
gagtttttgttcggtgcggctaagggcagtcgatgcgcagtgggggttttccccggaacc
ggcatcggtggtggctgcgtttacgaaggtcaaatcttgcacggcgacgggatctcttgc
atggagatcggtcatacgcgaatcagcagcggaacgcgtgcgagcggtagcagcatgtcg
ggaaccctggaagcggaagccagtcgactgacgatcgcatcggaagccgcgaaagccgcg
taccggggcgaggcccccgcgttgcttgaggacgccggcacggatttggcggaaatacgc
agtggagcgctggcggattcgatcaagaacggtgacaaggcgatcaaggcattggtggaa
tctgccagcgtcacggtcggttatggcgtggccaacatcgtgaacttgttgtgccctgac
acaatcatcttgggcggcggtttggtcgaagcgatggaagatttgatcgtgggcaccgtt
cgcaaaacggcacgcgaaaacgtgatgccggtctacaaagatcgcttcgaagtcaaaccc
gccaaactcggcgacgacgccggagtgttgggggcggcagcctgggcgaagaagacgtat
ccacaaccgcccgagtga

DBGET integrated database retrieval system