KEGG   Rhodopirellula baltica: RB13211Help
Entry
RB13211           CDS       T00134                                 

Definition
dolichol-phosphate mannosyltransferase-membrane bound sugar transferase involved in LPS biosynthesis (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
rba  Rhodopirellula baltica
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7087707..7090199)
Genome map
AA seq 830 aa AA seqDB search
MHAIETSHASTADTARMIAKTRRTPSITLILPAYNEAEVIADAIMEADSALSSITHRYEI
IVVDDGSSDATAEIVREFAKFIHSLRLIQHPRNQGYGAAIRSGFSAAQCDLVAFTDADCQ
FDLTELDRFVLLSERYDVVCGYRIDRKDSSLRCLYSKVYNLLVRAMLSPGVRDVDCALKM
FDVNVAKKLRITGDGFLVNSEMLTQANRLGHSVVEVGVSHRPRTLGQSTVSIKHIPNVLT
SLVRYWWNEVQFPTQTLMDRRNSETRSSGCFGLNPSWLQIGLIFIAAVFMFANLEYPLID
RDETRYAEIPREMIATGNWVLPQLNFETYYDKPPLLYWLCAISFQLFGISEASARFVPAL
AAICTLASTMFFGSRLFGRTVGLYAGVVLMLSVGFAFTSRYLLLDGVLALFVSLSLFTSL
EAIRNPTATVGKGSLHLGWWILSGVCIGLTFLTKGPIAIVLWLPPVLAMTWVSEAHARPR
WWHYGVLGGVASMIAAPWFLMVHLEDPAFLNEFFYRHNIARFAGEFHPKPIWYFLPVLLI
AGHPWSFLTIPYAKFLLSRDERSRRQRPPAVGYLLLWSGWCFTFFSLSSCKLPTYLLPAA
PALALLVGHYLHTVLADASHPEQHFFARFWSARSATATTCFAGVAFVIYVMIYTDDATVV
LFAWAMLWAALLISSLVLMADRHQVRIAWGTSSVVAFLFAVMVMHQMIPAYSRSQTLFGA
SSPVAKQLGVDESTPIATIEHEFSEVPFYLNRANIAHFARLRDQGIKRFLLRNSNCILIV
DSHIAIESLRDQLPAKSKIVPLLQRGPATLYRVSTVPNVDQLAQRETRSR
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctatcgaaaccagtcatgcgtcaaccgctgacacagccaggatgatcgcgaag
actcgccggacgccgtccatcaccctgatactgccggcttacaacgaagcggaagtgatc
gccgacgcaatcatggaagctgattcggcgctttcgtcaatcacgcatcgatacgaaatc
atcgttgtcgatgacggaagttctgacgcgacagccgagattgttcgcgagttcgcaaag
ttcattcactcgttgcgattgatccagcacccacgcaaccaaggttacggggcggcgatt
cgctccggtttctccgcggcacagtgtgacttggttgccttcaccgatgcggactgtcaa
ttcgatctgaccgaattggatcgtttcgtcttgctatcggaacgctacgacgtcgtttgt
ggctatcgcatcgaccggaaagattcgtcgctaaggtgcctttactcgaaagtctacaac
ctgctcgttcgagcgatgctcagccccggggttcgtgacgtcgattgcgctctcaagatg
tttgatgtcaacgtcgccaagaagttgcggatcaccggggacggcttccttgtcaattca
gaaatgctgacccaggcaaatcgccttggtcacagcgtcgtcgaggttggcgtctcgcac
cgaccacgcacgcttggccaaagcacggtctcgatcaagcacattccaaatgtactcacg
tcgctggtgcgttactggtggaacgaagtccagttcccgacccaaaccctcatggatcgc
cggaattcagaaacaagatcctcaggctgttttggcctgaacccgagctggttgcaaatt
ggactgatcttcattgcggcagtgttcatgtttgccaacctcgagtacccgctcattgat
cgcgacgaaacaaggtacgcggagatccctcgggaaatgatcgcaaccggcaactgggtt
ttgccgcaactcaatttcgagacctactacgacaaaccacccctgctgtactggctgtgc
gcgatcagcttccagttgttcggaatcagtgaagcatccgcccgcttcgttcccgctctc
gcggcgatctgcactttggcctccaccatgttctttggatcgcggctcttcggacgaacg
gtcggactatacgctggcgtcgtgctgatgctttcggtcggtttcgcattcaccagccgc
taccttttgctcgacggcgtgttggcactctttgtttcgctttcgctgttcacctcgctg
gaggcgattcgaaatccgactgcgactgttggcaagggttcattgcacctcgggtggtgg
atcctttcaggcgtttgcattggcttgacattcttgaccaaaggaccgatcgcgatcgtg
ctttggcttccacccgtgctggcaatgacttgggtatccgaagctcacgcacgcccaagg
tggtggcactacggagttctcggtggcgtcgcgtccatgatcgctgcaccttggtttctg
atggtgcacctcgaagaccccgcatttttgaacgagttcttctaccgacacaacatcgca
aggttcgccggcgagttccatcccaagcccatttggtatttcctgcctgtcctgctcatc
gccggtcacccatggtcctttctaacaatcccctatgccaagttcttgctgagccgcgac
gaaaggtctcgccgccaacgacctcctgccgtcgggtatctgctgctgtggagtggttgg
tgcttcacgtttttttctctgtcgagttgcaaattgcccacctatcttttgcccgccgct
ccggcactggcgttgctggtcggccattaccttcacaccgtactcgccgatgcaagtcat
cctgaacagcacttctttgctcgattctggtccgcacgttcggcaacggcgaccacttgt
tttgcaggcgtcgcatttgtgatctacgtgatgatctacaccgacgacgccaccgtcgtg
ctgttcgcttgggcgatgctgtgggccgctctgttgatttcgtccttggtgctgatggcg
gatcgacatcaggtccgaatcgcttggggaacttcctccgtggtcgctttcctgtttgcg
gtcatggtcatgcaccagatgattcccgcgtacagccgatcccaaacactcttcggagca
tcctctccagtggcgaagcaactcggggtcgacgaatccacaccgatcgcaaccatcgag
cacgaattctccgaagtgcccttttatctcaaccgagcgaacatcgctcacttcgcccgc
ctgagagaccaaggcatcaaacgcttcctgcttcgaaactcgaactgcattttgattgtt
gattcgcacatcgccattgaatcgctgcgagatcaactgcccgccaaaagcaaaatcgtc
ccgctgcttcaacgtggcccagcaacgctctaccgagtcagcaccgtcccgaacgtggac
caactcgctcaacgagaaacgcgttcgagatga

DBGET integrated database retrieval system