KEGG   Rhodopirellula baltica: RB13260Help
Entry
RB13260           CDS       T00134                                 

Gene name
yhdH
Definition
zinc-binding alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RB13260 (yhdH)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB13260 (yhdH)
  Lipid metabolism
   00071 Fatty acid degradation
    RB13260 (yhdH)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB13260 (yhdH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB13260 (yhdH)
   00626 Naphthalene degradation
    RB13260 (yhdH)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB13260 (yhdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7108384..7109364
Genome map
AA seq 326 aa AA seqDB search
MKGVLVEKDDSGIRAELRELDEQQLPEGNVTIRVHWSSFNYKDVLAITGKMPVIRSFPMV
PGIDLAGVVESSDDERYQVGQEVLVTGYGIGEAHWGGYAELARVPGDWLVPLPEGLTLRQ
SMAIGTAGFTAMLCVMALERGGVTPEQGPVLVTGAGGGVGSVAIGLLSKLGYEVAAVSGR
PEAEDYLKELGAREVLPRSDFSEPGKPLGKERWAGAVDVVGSHTLANICASTQYDGVVTA
CGLAGGMEFPATVAPFILRGVTLVGIDSVQCKQPRRSEAWQRLVEDLDLAKLETMTNEIQ
LDDVIKTAKNWGQSDHRGRVVVSVQG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgtcttggtcgaaaaggacgactcgggtattcgagctgaactacgagaactc
gatgagcagcaattgcccgagggcaacgtcaccattcgggtgcactggtcgagcttcaac
tacaaagacgtgctggcgatcacgggaaagatgccggtgattcgatcgttcccgatggtg
cccggaatcgatttggctggagtggtcgaatcgagcgacgacgaacgctatcaagtcggt
caagaggttttggtaacgggctacggaatcggtgaggctcactggggcgggtacgcggaa
ttggctcgtgtgcccggcgattggttggtgccattgcctgagggtttgacgctgcgtcaa
tcaatggcgatcgggacggccggtttcactgcgatgttgtgtgtgatggcgttggaacgt
ggcggtgtcacgcctgagcaaggcccggtcttggtgacgggggctggcggaggcgtcggt
agcgtcgcgatcggtttgctctccaagctggggtacgaagtcgcagccgtttcgggacgt
ccggaagctgaggactatttgaaagaacttggtgcccgtgaagtcttgccgcgatccgat
ttttcagagcccggcaaaccgctgggcaaagagcgttgggcgggggcggtggatgtggtc
ggcagtcacacgcttgcaaacatttgtgcgtccacccaatacgacggcgttgtgaccgcg
tgcgggttggctggtggaatggaatttcccgccactgtggctccgttcattctgcgaggc
gtgacgttggttggaatcgacagtgttcagtgcaagcaacctcgacgctcggaagcttgg
cagcgattggttgaagatttggacctggcgaaattggaaacgatgaccaacgagattcaa
ctggacgatgtgatcaagacggcgaagaattgggggcagagtgatcaccgtggacgagtt
gtggtgtcggttcagggttag

DBGET integrated database retrieval system