KEGG   Rhodopirellula baltica: RB13301Help
Entry
RB13301           CDS       T00134                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rba  Rhodopirellula baltica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rba00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rba00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7130204..7131286
Genome map
AA seq 360 aa AA seqDB search
MNSLSNQQVSEALSASAANSKGQKLSPLSLLDAFSGNIDRDALKALAGQSILNPRQFDRR
TVLAVAQLAALLESRNVEMDKPLDGKIAITAFFEPSTRTRLSFESAVQRLDGKVLSVPDG
QVTGIAKGESLADIGEMFNTYGDVVIMRHPDTDSMDEIQKNLQRPLINAGNGSGHHPTQA
LIDWYALLKWRPELHSDQCPPEKRVHLGIIGTPGSMRAVKSFLRLSLMFTGAVSKITLVS
EMADPVGLDLTEPIEQSPIPIEITNDVQEVLPQLDVVYVNSIAFLGDSYRNLDSRYSLDA
SSPFKDGAVIMHPLARNAELSEDLDETEHNLYFAQAAGAVFVRQALLAAVLDRTDRISGI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactttccaatcaacaggtgtcggaagcgttgagtgcatccgcggcaaattcc
aagggacaaaagttgtctcctttgtcgttgctggatgcatttagcggcaacattgatcgt
gacgcgctgaaggcgctcgcggggcagtcgatcttgaacccgcggcaattcgatcgccgg
accgttttggctgttgcgcagctcgctgcacttcttgagtcacgcaacgtcgaaatggat
aaaccgctggacggaaagatcgccatcacggctttcttcgaacccagcactcgaacccgg
ttgtcgtttgaaagcgccgtgcaacgactggatggaaaagtcctgtcagtgcccgatggg
caagtcaccgggattgccaaaggcgaatcattggcggacatcggggagatgttcaacacc
tacggcgacgtcgtgatcatgcgacaccccgacacggacagtatggacgagattcaaaag
aatcttcagcgaccgttgatcaatgctggcaacggttcgggacatcaccccacccaggca
ttgatcgactggtacgcgttgttgaaatggcgtccagaattgcactcggaccaatgcccg
cctgaaaaacgtgtgcatcttggaatcatcggcactcccggttcgatgcgagctgtgaaa
agctttctgcgtctgtcgctgatgttcaccggtgcggtcagcaaaatcacattggtcagc
gaaatggctgatccggttggactggatttgacggaaccgatcgaacagtcaccgattccg
atcgaaatcaccaacgatgtgcaggaagttcttccgcaactggatgtcgtctacgtgaat
tcgatcgcatttctaggcgacagttatcgcaatttggactcgcgttacagtctcgacgcg
agcagtcctttcaaagacggtgcggtgatcatgcatccgctcgctcgcaatgcggagctg
agcgaggacttggatgaaaccgaacacaatctctacttcgcccaggcggctggcgcggta
tttgttcggcaagcactcttggcagccgttttggatcgaaccgaccgaatcagcggtatc
tga

DBGET integrated database retrieval system