KEGG   Rhodopirellula baltica: RB1584Help
Entry
RB1584            CDS       T00134                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rba  Rhodopirellula baltica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rba01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rba00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814354..815736
Genome map
AA seq 460 aa AA seqDB search
MFRIVAVPEFSIQTVDARDPSSSEAAETLAALREKLSPRGDLVSPRGRELTLKVFGKALS
PIEVVETICKDVQSQGTEALLRYTKSLDGAELTADTLRVPEEDLKAAHAVADPKLIETIG
RIRDNIATFQSAILHRDVTITPRPGVSLTQRYVPIPRVGICVPGGAAAYPSTVMMTAIPA
QVAGVDEIAVVAPPTPFGAYNTDMLATCHELGIKEVYRCGGAQAVAAMAYGCDALPAVDK
IVGPGNLFVALAKKHVFGTVDIDSFAGPSEVIVIADESANAAFVASDLLAQAEHSPGSAI
LITWDESLLTSVQAELSRQLGELERGDLARDALSDFGALVLARDADHACELTDSFAPEHL
QIETREPESLIAKIRHSGAAFLGHHTPVALGDYAAGPSHVLPTGGTCRWAAGLSANSFLR
SGSVTQFDQSALSAIAQDVITVAEKEGLTAHARSISIRTE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgttccgcatcgttgccgtgcctgaattttccatccaaaccgttgacgctcgcgatccc
tcttcgagcgaagctgcggaaactctggcggcgttgcgagaaaagttgagtcctcgtggg
gacttggtcagtccgcgaggtcgtgagttgactttgaaagtgttcggcaaagctctgtcg
ccgatcgaagtcgtggaaactatttgcaaggatgttcaatcgcagggcaccgaggcactg
ctgcggtacaccaagtcgctcgacggggcggagttaacggccgacacgttgcgagttccg
gaagaagatttgaaggccgcccacgccgtggcggacccgaagctgatcgaaacgatcggc
cgaattcgcgacaacatcgccacgttccagtccgcgattttgcaccgcgatgtcacgatc
acgccgcggccaggagtctcactgacgcagcgatatgtgccgattcctcgcgtgggaatc
tgcgttcccggtggtgcggcggcttatccgtcaacggtgatgatgacggcgattccggct
caggttgctggtgtcgatgagatcgcggtggtcgctcctccgaccccatttggtgcttac
aacacggatatgctggcgacttgtcatgaactggggatcaaggaagtctatcggtgcgga
ggagcccaggcagtcgctgcgatggcgtacggatgcgacgccttgccggctgtcgacaaa
atcgtcggccccggaaacttgtttgtcgcactggcgaagaagcatgtgtttggcaccgtt
gacatcgattcgtttgcaggccccagcgaagtgatcgtgattgcggatgagtccgccaac
gcagcatttgttgcgtcggatttgttggcccaagccgaacactctcccggctcagcgatt
ttgatcacttgggatgagtcattgctgacgagcgttcaggcagaattgtcgcggcagctc
ggcgaactggagcgtggcgatttggctcgcgatgcgttgtcagatttcggagccttggtg
ttggctcgtgatgccgatcacgcttgcgaattgaccgactcgtttgcaccggaacacttg
caaatcgaaactcgcgagccggaatcgttgatcgcgaagattcggcacagcggagctgcg
tttttggggcaccatactccggtcgcgttgggggactacgccgccgggcccagtcacgtt
ttgccgacggggggcacgtgccgatgggccgcagggttgtcagcgaacagctttctgcgg
tctggcagtgtgactcagttcgatcaatcggctttgtcggcaatcgctcaggatgtgatc
acggtggcggagaaagagggcctgaccgcccacgcccgcagcatctcgatccgaacggaa
tga

DBGET integrated database retrieval system