KEGG   Rhodopirellula baltica: RB1856Help
Entry
RB1856            CDS       T00134                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rba  Rhodopirellula baltica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RB1856
Enzymes [BR:rba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RB1856
Exosome [BR:rba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RB1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957840..959054
Genome map
AA seq 404 aa AA seqDB search
MGWVGRGEIRKRPFPNVIERGISLAERPGRLGTFCDAKWKHLAADECPKITSAAVPLSIL
WVFVLSQFSGSPAPRAAFPATRLRRVRATDWSRRLVRETTLSVDDLIWPLFVMDGSGQQP
VGSLPGVNRLGESEIVAAAKRAVDLGIPAIALFPATDPKLKSEDAAEAYNSDNLVCRVTR
QIKDAVGDSLGVILDVALDPYSSHGQDGLVQDGQVINDETVDVLCKQAIVQASAGCDVIA
PSDMMDGRIGAIRSALDGAGHSGVQIMSYAAKYASAFYGPFRDAVGSAANLGAADKKTYQ
QSPSQSDEAIAEVALDLAEGADSVMVKPGMPYLDIVARVKQTFGVPTFAYQVSGEYAMLR
GAADAGWLSGDAVILESLLSFKRAGADGVLTYFAADAAELLHRS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggggtgggtggggcgaggtgaaattcgaaaacgtccctttccgaacgtgattgagcgg
gggattagtttagcagaacggccgggtaggcttggcacgttctgtgacgcaaaatggaaa
catctcgcagcggacgagtgtccaaagatcacgtccgccgctgttcctctatcgattcta
tgggtgttcgttttgtcccaattctccggctctcccgctccccgtgccgctttccccgcc
acccgattgcgtcgcgttcgggcgacggattggtctcgccgtctcgtccgggaaacgacc
ttgtcggtggacgatctgatctggccacttttcgtgatggatggatcgggccagcagccg
gtcggatcgctgcccggcgtgaatcggctgggggaatccgaaattgtcgcggcggccaaa
cgcgccgttgacctggggattcccgcgatcgccttgtttcccgccaccgacccgaaactc
aaatcggaagacgcagccgaagcgtacaactcggacaatctggtttgccgggtcacgcgg
caaatcaaggatgcggtgggcgattcgctgggggtgatcttggatgtcgccttggacccc
tacagcagccacgggcaggacgggctggttcaagatgggcaagtcatcaacgacgagacc
gtggatgtgctgtgcaagcaagcgatcgtgcaagcctcggctggctgcgacgtcatcgcg
ccgagtgacatgatggatggtcgcattggagcaatccgatcggctctggatggtgccggg
cattcgggcgttcagatcatgtcgtatgcggccaagtacgctagcgcgttctatgggccg
ttccgagacgcggtcggatccgcggccaatcttggtgcggcggacaagaagacctaccag
caatcaccgtcccagtcggatgaagcgatcgcggaagttgcattggacttggctgagggc
gccgatagcgtgatggtgaaaccggggatgccatacttggacatcgtcgctcgcgtgaag
caaacctttggcgtgccaacgtttgcttatcaggtcagcggcgaatacgcgatgctgcgt
ggtgccgccgacgccggatggttgagcggtgacgcagtgattttggaaagcttgctttcg
ttcaaacgtgccggtgccgatggcgtgctgacttacttcgccgctgacgccgcagaactg
cttcaccgcagttga

DBGET integrated database retrieval system