KEGG   Rhodopirellula baltica: RB1874Help
Entry
RB1874            CDS       T00134                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rba  Rhodopirellula baltica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966194..967177)
Genome map
AA seq 327 aa AA seqDB search
MPTQCLISFGSNLGDRRVVIAEAARRVAESGVIAEPCTDLSGGSAEEPVQRLRTSRLFET
PPIGGPGGQSPFLNAVAAFATEASAAEVLDVLQHLEIDLGRKRLIRWGARVIDLDVVLHG
RLAGSASTAGRRGLIGGRGPAGSAKALVVPHPRYTARRFVLEPACDVAADFCDPRFGWTI
RDLRDHIAADVPSIALVGGDSKLRQIICQRLSSEHGIAVIDPNRPDAAKGLQQWVAADPP
LALRDSKEIDQDTSPTSQCLPRLLARIQHTTEKDRWPAPHQIWPAGWKWPEYRLEVDDLD
WAIGELASAMDSMRCEIHPTTDDGRWW
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcagtgcctcatcagcttcggatcgaacctgggtgaccgccgcgtcgtgatc
gccgaagcggcacgtcgggtggctgagtcgggtgtcatcgccgaaccttgtacagatctt
tctggcggttccgccgaagaacctgttcaacgacttcgaaccagccggctattcgaaacc
ccaccaatcggcggccccggcggtcaatcaccgtttctgaacgcggtcgccgcgtttgcg
acagaagcgtctgcggcggaagtcttggacgtgctgcaacatctcgagatcgacctgggc
cgcaagcgtttgattcgctggggcgcccgcgtgatcgacttggacgttgtccttcacggt
cgcctagcaggttccgccagcacagctgggcgccgcggtctgatcggcggtcgcgggccg
gccggttcggcgaaagcattggtcgttccgcatcctcgatacaccgcccgacgattcgtc
ttggaaccggcttgcgatgtcgccgccgacttctgcgacccgcgttttggttggacaatt
cgggacctgcgagatcatatcgctgcggacgtgccatccatcgctttggtgggcggagat
tcaaagcttcgacaaatcatttgccagcgtttgtcttccgaacacggaatcgcggtcatc
gatccaaatcgccccgatgcggcaaagggtttgcagcaatgggtcgcggccgatccgcca
ttggcactgcgtgattccaaggagattgaccaagacacttcgccgacgtcgcagtgtctg
cccaggttgctcgctcgaatccagcacacaaccgagaaagatcgatggccggcaccgcat
caaatttggcccgccggatggaagtggcccgaataccgattggaagttgacgacctggat
tgggccatcggcgagctcgcctccgcgatggattccatgcgatgcgagatccaccccacc
acggacgacggccgctggtggtga

DBGET integrated database retrieval system